khaan daan - خاندان meanings in English
khaan daan - خاندان meanings in English are clan, family ranunculaceae, family rajidae, family entomophthoraceae, family callithricidae, family callionymidae, kin, family tree, strain, sept, lineage, household, family, dynasty, cohort, stonecrop family khaan daan - خاندان in English. More meanings of khaan daan - خاندان, it's definitions, example sentences, related words, idioms and quotations.
clan family ranunculaceae family rajidae family entomophthoraceae family callithricidae family callionymidae kin family tree strain sept lineage household family dynasty cohort stonecrop family
khaan daan - خاندان Definitions
Please find 44 English and definitions related to the word khaan daan - خاندان.
- (noun) : group of people related by blood or marriage
- (noun) : a band of warriors (originally a unit of a Roman Legion)
- (noun) : a company of companions or supporters
- (noun) : a group of people having approximately the same age
- (noun) : a sequence of powerful leaders in the same family
- (noun) : a collection of things sharing a common attribute
- (noun) : people descended from a common ancestor
- (noun) : an association of people who share common beliefs or activities
- (noun) : a person having kinship with another or others
- (noun) : (biology) a taxonomic group containing one or more genera
- (noun) : primary social group; parents and children
- (noun) : group of people related by blood or marriage
- (adjective satellite) : related by blood
- (noun) : a person having kinship with another or others
- (noun) : inherited properties shared with others of your bloodline
- (noun) : a rate of payment for written material that is measured according to the number of lines submitted
- (noun) : the number of lines in a piece of printed material
- (noun) : the kinship relation between an individual and the individual's progenitors
- (noun) : people descended from a common ancestor
- (noun) : the month following August and preceding October
- (noun) : a special variety of domesticated animals within a species
- (verb) : alter the shape of (something) by stress
- (verb) : separate by passing through a sieve or other straining device to separate out coarser elements
- (noun) : difficulty that causes worry or emotional tension
- (verb) : test the limits of
- (verb) : to exert much effort or energy
- (noun) : an intense or violent exertion
- (noun) : (physics) deformation of a physical body under the action of applied forces
- (noun) : injury to a muscle (often caused by overuse); results in swelling and pain
- (noun) : (psychology) nervousness resulting from mental stress
- (noun) : the act of singing
- (noun) : an effortful attempt to attain a goal
- (verb) : use to the utmost; exert vigorously or to full capacity
- (verb) : rub through a strainer or process in an electric blender
- (noun) : the general meaning or substance of an utterance
- (verb) : cause to be tense and uneasy or nervous or anxious
- (verb) : become stretched or tense or taut
- (noun) : dragonets
- (noun) : marmosets
- (noun) : mostly parasitic lower fungi that typically develop in the bodies of insects
- (noun) : bottom-dwelling tropical rays: skates
- (noun) : a family of Ranunculaceae
- (noun) : successive generations of kin
- (noun) : succulent shrubs and herbs
More words related to the meanings of khaan daan - خاندان
More words from English related to khaan daan - خاندان
View an extensive list of words below that are related to the meanings of the word khaan daan - خاندان meanings in English in English.
affiliationaffinityappertainco operationconcernkinkindredaggregateaggregate numberdynastyeaseengine entirefullygeneralginlivelongpiecelessteetotala good manyallcompleteeachgrossmorrowsumtomorrowtotaluniversesubtotaltotaledmorrowstomorrowstotalisedtotalizestotalledtotallingtotalstotienttottedyesterdaysagreeablypursuantlineagepedigreeaquosityfamilyarchetypearchetypalcapital ... essence fundamentalgenuinematterprincipalbasicfoundation germhypostasisoriginoriginalpurequidrealrootrudimentsourcestocktrueactinaloriginativeoriganoriginalsoriginableoriginantoriginaryphrenticarrestconfinedissuadeencumber immanacleletobjectobstructobviatepreventprescribesquenchtaboovetowardwithholdavertbarcheckcohibitcontaincurbdetainfendforestallhefthinderimpedeinhibitinterdictinterfereknock offoccludeprohibitrepressrestrainstintstopstrainward offclog upcurbingdiscontinuancefend forfend offinhibitedinhibitorinhibitorykerbobtrude uponwithholdingcurbeddisinhibitfendingfendsforhentinghalteringinhibitinginhibitivewithholdeninterceptingobstringeprelimitbreedkinddescentextractiongenealogygenerationprogenyracespawnethnicitygenus eaclesposteritybredbrededbreregennedgentesinbreedoutbreedareedbreededescendantegoentitypersonasibsubstantivebirthcastedenominationnatureselvessubstanceverygnarlhouseholdhousebrotherhoodclancousincommunitycommunitiesbungalowcapsuledwellingedificefire sideholehomemortisenestbirthplacecasehabitathabitationholderresidenceshebangspacehouherehomedhouselcircumscriptioncloseenclosuregirdletermbawnfencelimitationmewpaleparvisseptyardperimetercircummurecoverallsclutchgripmanubriumphalanxquirebrigadecohortcontingentdoorknobfleethafthiltknophandsturncognatekinsfolkkinsmankith and kinrelativetribeclannishclannishnessclansmanclanshipclavationtribolettribracteatecorrespondentlikeresemblerresemblersdarlingduckyliefbeloveddearesteemedfavouritegermanhonouredrespectedpreciousdear boughtdear loveddearborndrainsqueezeextortextractpercolatewringcrimperscrew upsqueakersquealingsqueezabilitysqueeze bysqueeze outsqueezeruncompressbrutifyingcrimpysnoutingsqueakingssqueakssqueezerssqueezessqueezingssqueezysqueggingsqueteaguecontramureexcrementizescinkbuncebunsbunceseconomiceconomisteconomy housekeepingfamily bombycidaefamily gyrinidaefamily mobulidaefamily varanidaemenagefilerangesystemchainconnectionlinklinkagepurviewqueuesequenceseriessuccessionstreelfiltergarblesievesiftsyewinnowfore fatherprogenitorshomelytamedomesticinteriorcircumlocutorydomesticateddomesticationdomesticisedomesticityhome basehomeyhousecleanhousefulundomesticatedbesottedlygharrieshomelierhomeliesthomelilyhomiesthousefulshouselleddomesticaldomesticantdomesticatorhomesteadedge hawhedgespatetribeskinshipnearnessunionuniquealliancerapportrelatednessrelationrelationshipstringthreadosseletboneboneletcordgrassherdessspecificationtypebotherbotherationinconveniencepaintroubleagnomenagrimonyaguishbaredtancredagnomensaglutitionagnominationexornationancestresslineationlineageslineaturefamily treeforefatherskinfolkrelatiativerelationalrelative in lawablativeskinchinskingedkininskinsfolkskinsmenrelatives
Idioms with the word khaan daan - خاندان in it
Idioms related to the meaning of khaan daan - خاندان
What are the meanings of khaan daan - خاندان in English?
Meanings of the word khaan daan - خاندان in English are clan, cohort, dynasty, family, household, kin, lineage, sept, strain, family callionymidae, family callithricidae, family entomophthoraceae, family rajidae, family ranunculaceae, family tree and stonecrop family. To understand how would you translate the word khaan daan - خاندان in English, you can take help from words closely related to khaan daan - خاندان or it’s English translations. Some of these words can also be considered khaan daan - خاندان synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word khaan daan - خاندان. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use khaan daan - خاندان in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say khaan daan - خاندان in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of khaan daan - خاندان with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by خاندان?
Meanings of خاندان are clan, cohort, dynasty, family, household, kin, lineage, sept, strain, family callionymidae, family callithricidae, family entomophthoraceae, family rajidae, family ranunculaceae, family tree and stonecrop family
Whats the definition of خاندان?
Definition of the خاندان are
- group of people related by blood or marriage
- a band of warriors (originally a unit of a Roman Legion)
- a company of companions or supporters
- a group of people having approximately the same age
- a sequence of powerful leaders in the same family
- a collection of things sharing a common attribute
- people descended from a common ancestor
- an association of people who share common beliefs or activities
- a person having kinship with another or others
- (biology) a taxonomic group containing one or more genera
- primary social group; parents and children
- group of people related by blood or marriage
- related by blood
- a person having kinship with another or others
- inherited properties shared with others of your bloodline
- a rate of payment for written material that is measured according to the number of lines submitted
- the number of lines in a piece of printed material
- the kinship relation between an individual and the individual's progenitors
- people descended from a common ancestor
- the month following August and preceding October
- a special variety of domesticated animals within a species
- alter the shape of (something) by stress
- separate by passing through a sieve or other straining device to separate out coarser elements
- difficulty that causes worry or emotional tension
- test the limits of
- to exert much effort or energy
- an intense or violent exertion
- (physics) deformation of a physical body under the action of applied forces
- injury to a muscle (often caused by overuse); results in swelling and pain
- (psychology) nervousness resulting from mental stress
- the act of singing
- an effortful attempt to attain a goal
- use to the utmost; exert vigorously or to full capacity
- rub through a strainer or process in an electric blender
- the general meaning or substance of an utterance
- cause to be tense and uneasy or nervous or anxious
- become stretched or tense or taut
- dragonets
- marmosets
- mostly parasitic lower fungi that typically develop in the bodies of insects
- bottom-dwelling tropical rays: skates
- a family of Ranunculaceae
- successive generations of kin
- succulent shrubs and herbs
What is the synonym of خاندان?
Synonym of word خاندان are برادری, چھوٹا قبیلہ, خاندان, قبیلہ, کنبہ, دستہ, فوج کا پرا, ہم سلسلہ, کل, گھرانا
What are the idioms with the word خاندان?
Here are the idioms with the word خاندان in them.
- Of kin
- Scarch not for a good man's pedigree
- The older the blood the less the pride
What are the idioms related to خاندان?
Here are the idioms that are related to the word خاندان.
- Strain courtesy
- To swallow a camel and strain at a gnat
- Everyone is kin to the rich man
- I am myself my own nearest of kin i am dearest to myself
- Kith and kin