ماس مچھلی meanings in English
ماس مچھلی meanings in English is fish ماس مچھلی in English. More meanings of ماس مچھلی, it's definitions, example sentences, related words, idioms and quotations.
ماس مچھلی Definitions
Please find 7 English and definitions related to the word ماس مچھلی.
- (noun) : any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- (noun) : the flesh of fish used as food
- (noun) : (astrology) a person who is born while the sun is in Pisces
- (noun) : the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- (verb) : catch or try to catch fish or shellfish
- (verb) : seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
More words related to the meanings of ماس مچھلی
Fish | بنسی کھیلنا مچھلی کا شکار کرنا ڈگن مارنا مچھلی machhli مچھلی machli مچھی مین Meen متس Matas ماہی maahi ماہی Mahi جل تری مچھلی کا گوشت ماس مچھلی مچھلی پکڑنا machhli pakarna |
More words from English related to ماس مچھلی
View an extensive list of words below that are related to the meanings of the word ماس مچھلی meanings in English in English.
fishmusclealligator pearalligatorfishcrampfishfiscfisheyefishwifelobe finned fishmay fishpiscatorypiscinestill fishsweetbriarbeeswingcramponscrocketscrocoisitecubsfiscalsfiscsfishablefishedfishinessfisksfistianamishmashespiscariespisciformpiskiespissoirssweetfishbearishnesscich peafleshquakefriesishpiscationpiscinalpiscesmainejack tarpiscicapture
Idioms with the word ماس مچھلی in it
Idioms related to the meaning of ماس مچھلی
What are the meanings of ماس مچھلی in English?
Meanings of the word ماس مچھلی in English is fish. To understand how would you translate the word ماس مچھلی in English, you can take help from words closely related to ماس مچھلی or it’s English translations. Some of these words can also be considered ماس مچھلی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word ماس مچھلی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use ماس مچھلی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say ماس مچھلی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of ماس مچھلی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ماس مچھلی?
Meaning of ماس مچھلی is fish
Whats the definition of ماس مچھلی?
Definition of the ماس مچھلی are
- any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- the flesh of fish used as food
- (astrology) a person who is born while the sun is in Pisces
- the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- catch or try to catch fish or shellfish
- seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
What is the synonym of ماس مچھلی?
Synonym of word ماس مچھلی are بنسی کھیلنا, مچھلی کا شکار کرنا, ڈگن مارنا, مچھلی, مچھی, مین, متس, ماہی, جل تری, مچھلی کا گوشت
What are the idioms with the word ماس مچھلی?
Here are the idioms with the word ماس مچھلی in them.
- A rotten sheep infects the whole flock
- A single sinner sinks the boat
- Fishes follow the bait
- In the deepest water is the best fishing
- One fish infects the whole water
What are the idioms related to ماس مچھلی?
Here are the idioms that are related to the word ماس مچھلی.
- A fish out of water
- All fish are not caught with flies
- All is fish that comes to his net
- Better small fish than an empty dish
- Daughters and dead fish are not keeping wares