nuskhah - نسخہ meanings in English
nuskhah - نسخہ meanings in English are copy, epistyle, epithem, epitheton, epistolical, epistome, prescriptibility, presignification, prespinal, presstriction, epinasty, superscription, prescript, decoction, edition, prescription, recipe, transcription, version, volume, ascription, ethnarch, rescription nuskhah - نسخہ in English. More meanings of nuskhah - نسخہ, it's definitions, example sentences, related words, idioms and quotations.
copy epistyle epithem epitheton epistolical epistome prescriptibility presignification prespinal presstriction epinasty superscription prescript decoction edition prescription recipe transcription version volume ascription ethnarch rescription
nuskhah - نسخہ Definitions
Please find 35 English and 1 Urdu definitions related to the word nuskhah - نسخہ.
- (noun) : matter to be printed; exclusive of graphical materials
- (noun) : material suitable for a journalistic account
- (noun) : a reproduction of a written record (e.g. of a legal or school record)
- (verb) : make a replica of
- (verb) : copy down as is
- (verb) : reproduce someone's behavior or looks
- (noun) : a thing made to be similar or identical to another thing
- (verb) : reproduce or make an exact copy of
- (noun) : the act of arranging and adapting a piece of music
- (noun) : a sound or television recording (e.g., from a broadcast to a tape recording)
- (noun) : something written, especially copied from one medium to another, as a typewritten version of dictation
- (noun) : (genetics) the organic process whereby the DNA sequence in a gene is copied into mRNA; the process whereby a base sequence of messenger RNA is synthesized on a template of complementary DNA
- (noun) : the act of making a record (especially an audio record)
- (noun) : the property of something that is great in magnitude
- (noun) : the magnitude of sound (usually in a specified direction)
- (noun) : a publication that is one of a set of several similar publications
- (noun) : the amount of 3-dimensional space occupied by an object
- (noun) : a relative amount
- (noun) : physical objects consisting of a number of pages bound together
- (noun) : assigning to a cause or source
- (noun) : assigning some quality or character to a person or thing
- (noun) : (pharmacology) the extraction of water-soluble drug substances by boiling
- (noun) : the form in which a text (especially a printed book) is published
- (noun) : an issue of a newspaper
- (noun) : all of the identical copies of something offered to the public at the same time
- (noun) : the ruler of a province (as in the Roman Empire and Byzantine Empire) or certain religious rulers with secular authority
- (noun) : prescribed guide for conduct or action
- (noun) : a drug that is available only with written instructions from a doctor or dentist to a pharmacist
- (noun) : written instructions from a physician or dentist to a druggist concerning the form and dosage of a drug to be issued to a given patient
- (noun) : written instructions for an optician on the lenses for a given person
- (adjective) : available only with a doctor's written prescription
- (noun) : directions prescribed beforehand; the action of prescribing authoritative rules or directions
- (noun) : directions for making something
- (noun) : the activity of superscribing
- (noun) : an inscription written above something else
- آہنگ یا ساز کے لیے کسی نَغمے کی اُس نغمے کے علاوہ تَرتیب جس کے لیے وہ پہلے لِکھا گیا تھا
More words related to the meanings of nuskhah - نسخہ
More words from English related to nuskhah - نسخہ
View an extensive list of words below that are related to the meanings of the word nuskhah - نسخہ meanings in English in English.
apeemulatefollow:gesticulateimitatemimicmockmodelnarratequotesimulatetranscribingactcopycounterfeitduplicateimpersonatepersonaterelateremittake aftertranscribetransferduplicatingaphorismdictumlikelikenessquasiwakeanalogousexampleproverbrecordresemblingsimilarbignessgrossnesshugenessmagnitudesymmetrybodybulkburlinesscorpulencecorpulencyheftlargenessmassivenessquantity ... volumebigquantumdosagemassquantalquantifiabilityquantifiablequantifierquantisationquantisequantongvolumetricvolumetricalamountsqualmsquanticsquantifiedquantifiesquantisedquantisesquantisingquantitivequantsquittancesvolutesquatuorquitturequotietythicknesshymenealsvolumedvoluminositysizeschartcontourdrawingfiguremannermapmodulemouldprofiletenorconditiondelineationdesignfeaturesplanportraitpredicamentprospectsketchindraftengraftationcomedycomfitcounterpartfablegesticulationmimerypersonagespoofetaleactinganecdoteapingcopyingexemplarimitatingimitationimpersonationmimickingmimicrymockernarrationnarrativeprintreplicareproductionsimulationstorytranscriptduplicabilityduplicableduplicatablereduplicationreplicationtranscribedduplicatedreplicatescentuplicateconduplicateconduplicationduplicatureinduplicatereplicantconversiondiversity immutationvarianceversatilityversionalterationmodificationtransformationvariablityvicissitudemutabilitymutismvariabilitymutulemutuationcopiedcoppedcoppycopistversionscureobviationtherapyantidotehealingmedical treatmentmedicationmedicineprescriptionpunishmentreformationreliefremedytreatmentanureticcuretcuringtherapeuticaltherapeuticscurescurettedhereatremededremedesremediedremediesremedingremedyingtherapiestreatingtreatingscurationtreatureearly epidermis fleetlyquicksharplybinding of a bookbriskbrisklycuticlecutisdermfastinstantquicklyrapidskinsoonspeedyvolumeof a bookprecipitatenessvolvolostskinchmakemakingmanoeuvremixturenaturesynthesistempercompositionconfigurationconstructiondecoctioninventionmethodmodereciperusetricksyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismsubstitutionappositionchangeequivalent ersatzexchangetranscriptiontranslationtranslavationportrayreplicatetrace
Idioms related to the meaning of nuskhah - نسخہ
What are the meanings of nuskhah - نسخہ in English?
Meanings of the word nuskhah - نسخہ in English are copy, transcription, version, volume, ascription, decoction, edition, ethnarch, prescript, prescription, recipe, superscription, epinasty, epistyle, epithem, epitheton, epistolical, epistome, prescriptibility, presignification, prespinal, presstriction and rescription. To understand how would you translate the word nuskhah - نسخہ in English, you can take help from words closely related to nuskhah - نسخہ or it’s English translations. Some of these words can also be considered nuskhah - نسخہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word nuskhah - نسخہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use nuskhah - نسخہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say nuskhah - نسخہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of nuskhah - نسخہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by نسخہ?
Meanings of نسخہ are copy, transcription, version, volume, ascription, decoction, edition, ethnarch, prescript, prescription, recipe, superscription, epinasty, epistyle, epithem, epitheton, epistolical, epistome, prescriptibility, presignification, prespinal, presstriction and rescription
Whats the definition of نسخہ?
Definition of the نسخہ are
- matter to be printed; exclusive of graphical materials
- material suitable for a journalistic account
- a reproduction of a written record (e.g. of a legal or school record)
- make a replica of
- copy down as is
- reproduce someone's behavior or looks
- a thing made to be similar or identical to another thing
- reproduce or make an exact copy of
- the act of arranging and adapting a piece of music
- a sound or television recording (e.g., from a broadcast to a tape recording)
- something written, especially copied from one medium to another, as a typewritten version of dictation
- (genetics) the organic process whereby the DNA sequence in a gene is copied into mRNA; the process whereby a base sequence of messenger RNA is synthesized on a template of complementary DNA
- the act of making a record (especially an audio record)
- the property of something that is great in magnitude
- the magnitude of sound (usually in a specified direction)
- a publication that is one of a set of several similar publications
- the amount of 3-dimensional space occupied by an object
- a relative amount
- physical objects consisting of a number of pages bound together
- assigning to a cause or source
- assigning some quality or character to a person or thing
- (pharmacology) the extraction of water-soluble drug substances by boiling
- the form in which a text (especially a printed book) is published
- an issue of a newspaper
- all of the identical copies of something offered to the public at the same time
- the ruler of a province (as in the Roman Empire and Byzantine Empire) or certain religious rulers with secular authority
- prescribed guide for conduct or action
- a drug that is available only with written instructions from a doctor or dentist to a pharmacist
- written instructions from a physician or dentist to a druggist concerning the form and dosage of a drug to be issued to a given patient
- written instructions for an optician on the lenses for a given person
- available only with a doctor's written prescription
- directions prescribed beforehand; the action of prescribing authoritative rules or directions
- directions for making something
- the activity of superscribing
- an inscription written above something else
- آہنگ یا ساز کے لیے کسی نَغمے کی اُس نغمے کے علاوہ تَرتیب جس کے لیے وہ پہلے لِکھا گیا تھا
What is the synonym of نسخہ?
Synonym of word نسخہ are نقل کرنا, مثل, نقشہ, نقل, کاپی, نُسخہ, ہربہ, نسخہ, چربہ اتارنا, طرح اڑانا
What are the idioms related to نسخہ?
Here are the idioms that are related to the word نسخہ.
- The requisite for obtaining copy
- We are all quick to copy what is base and depraved