pichaeti - پچیتی meanings in English
pichaeti - پچیتی meanings in English are cleverness, fraud, trick pichaeti - پچیتی in English. More meanings of pichaeti - پچیتی, it's definitions, example sentences, related words, idioms and quotations.
pichaeti - پچیتی Definitions
Please find 12 English and definitions related to the word pichaeti - پچیتی.
- (noun) : intelligence as manifested in being quick and witty
- (noun) : the property of being ingenious
- (noun) : the power of creative imagination
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (noun) : intentional deception resulting in injury to another person
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
More words related to the meanings of pichaeti - پچیتی
More words from English related to pichaeti - پچیتی
View an extensive list of words below that are related to the meanings of the word pichaeti - پچیتی meanings in English in English.
acerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpeditenessrapacesfastartfulnessmanoeuvrepromptitudequirkinessrusesliness ... alacritycraftinessdeftnessfoxinessfraudknackmanipulationtacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnesschouscross biteguilehoaxhypocrisyillusionimposturejugglelegerdemainshamcheatingdeceitdeceivingdeceptiondouble dealingfallowgriftjuggleryliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationcheatcircumventionfeint huskbandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphniccautioncharinessdiscreetnessoutlookvigilancewakefulnesswarinesswatchfulnessintelligenceknow what's whatceremonialcraftgadgetmachinationmotionmovemovementpassagestepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapewaterdiversion duplicityhoodwinkingsophistryburnscircumlocutiondifferenceturningwindingdiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangecirclecoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawnhumbuginsincerityquizgrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingintrigueloveplotrelationrelevancyloggepretextdevicedisguise excusequibbletrepanhocusjugglingsleightmakemakingmixturenaturesynthesistempercompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningopportunitymurderambushartificemaximphilosophysciencestalecontrivancediplomacyginingenuityknowledgeskillwisdomwisenessaffectationairscoquetryflirtingpretenceswaggerartneatnessworkmanshipbeguilementdamagelosschacmacoaxinveigleseducediscrepancymessdabmopseductionmagicmiraclefeigningpretentionevasion frictiongashhack
Idioms related to the meaning of pichaeti - پچیتی
What are the meanings of pichaeti - پچیتی in English?
Meanings of the word pichaeti - پچیتی in English are cleverness, fraud and trick. To understand how would you translate the word pichaeti - پچیتی in English, you can take help from words closely related to pichaeti - پچیتی or it’s English translations. Some of these words can also be considered pichaeti - پچیتی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word pichaeti - پچیتی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use pichaeti - پچیتی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say pichaeti - پچیتی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of pichaeti - پچیتی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by پچیتی?
Meanings of پچیتی are cleverness, fraud and trick
Whats the definition of پچیتی?
Definition of the پچیتی are
- intelligence as manifested in being quick and witty
- the property of being ingenious
- the power of creative imagination
- something intended to deceive; deliberate trickery intended to gain an advantage
- intentional deception resulting in injury to another person
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
What is the synonym of پچیتی?
Synonym of word پچیتی are تیزی, چالاکی, ہوشیاری, حکمت, کاری گری, پچیتی, فریب, چھل, پٹی, جل
What are the idioms related to پچیتی?
Here are the idioms that are related to the word پچیتی.
- Cleverness seeks cleverness
- It is a fraud to conceal a fraud
- Fraud is safe in no hiding place
- It is a fraud to accept what you cannot repay
- One trick needs a great many more to make it good