chakma - چکما meanings in English
chakma - چکما Definitions
Please find 28 English and definitions related to the word chakma - چکما.
- (noun) : loss of military equipment
- (noun) : the occurrence of a change for the worse
- (noun) : the amount of money needed to purchase something
- (verb) : inflict damage upon
- (noun) : any harm or injury resulting from a violation of a legal right
- (verb) : suffer or be susceptible to damage
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (verb) : subject to a playful hoax or joke
- (noun) : an entertainment that provokes pleased interest and distracts you from worries and vexations
- (noun) : magnetic personal charm
- (noun) : greyish baboon of southern and eastern Africa
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (noun) : intentional deception resulting in injury to another person
- (noun) : euphemistic expressions for death
- (noun) : the disadvantage that results from losing something
- (noun) : the act of losing someone or something
- (noun) : the experience of losing a loved one
- (noun) : military personnel lost by death or capture
- (noun) : the amount by which the cost of a business exceeds its revenue
- (noun) : something that is lost
- (noun) : gradual decline in amount or activity
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
More words related to the meanings of chakma - چکما
More words from English related to chakma - چکما
View an extensive list of words below that are related to the meanings of the word chakma - چکما meanings in English in English.
abatementdiminutiondrawbackfailurefalling fewnesslessmitigationpalliationpaucityquantitativescantinessscarcityshortcomingshortfallslendernesswantdearthdeficiencydeficitimpairmentinsufficiencylacklackinglossmeagernesspenuryreductionrelaxationremissionscantshortagewanecommiedecrementdepletionincipiencylackadaisicallyreductioreductionistcrunchesdearthsdecrementsdecrewdeficiencedeficientsdemountsdepletionsdepletivefallowness ... lackadaisylackadaylackedlackerlackeringlacklandlacklandsreductionsreduitsscarcitiesshortfallsdecipiencydeclivitiesdecreationdecrepitatingdecretiondepurediductionindeficiencyreducementlack ofdecreaseactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxinessfraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessappulsebruisebumpdamageimpetusimpingementimpulseimpulsionstartleafflictionbereavementblowcalamitycollisionconcussionhurtjarshocksufferingtraumatraumataaggrievancechouscross biteguilehoaxhypocrisyillusionimposturejugglelegerdemainshamcheatingdeceitdeceivingdeceptiondouble dealingfallowgriftjuggleryliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationcheatcircumventionfeint huskbandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbitter sweetsportbeguilementdiversion lureblotchblemishblotblotscauterizationcauterydiscolorationescharfleckmarktainttarnishebotchbrandgriefinfamymaculamoilescarspeckspotstainstigmablemishedindentionmolalitystainerstainingblemishesmolalitiesscarringstainersstainingsstainsstintsstunstarnsblemishmentbreakbreakagedissolutionfractureabruptionbreakingbreak apartbroken downtootcarvingcorrosioncuttingerosionmordacityacuitybitecountercounter movecutdisconnectionenmityincisionrejoindersharpnessslashchop offcut outcut upcutoutcottceremonialcraftgadgetmachinationmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapbluffgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapewaterduplicityhoodwinkingsophistryburnscircumlocutiondifferenceturningwindingdilapidation disservice encumbrances hurtfulnesshurtlessmischiefmissdestructiondetrimentharmhavocinjuryreversescathewastagewasteincurvationdamnationsdamnifiesdetrudesdowncomeharmineoncomedamnificationimpunityruindiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangediscomfiture erfestoonfoilfrustrationgarlandnecklaceoverthrowroutcheckmatedefeatfatiguesurrenderwhippingwreathhaarloselsnecklacesnecklacedrapaciouscirclecoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawnfizzyindemnitiesfoolingfoolifystupifyfaultinessknaverymischievousnessnaughtinesspranktermagancywaggerywaggishnessbalebamgullimpishnessknavishnessquizrigvicevillainywickednesshumbuginsincerityfrayexcoriategrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingintrigueloveplotrelationrelevancyloggepretextdevicedisguise excusequibbletrepanjilthocuspalaverbrewunderminevitiatedetribalisedamnifyharmingjugglingsleightmakemakingmixturenaturesynthesiscompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningopportunitymurderambushartificeseditiontroublemulctfine penaltyransombreachdefectflawfractionabsencenegationaffectationairscoquetryflirtingpretenceswaggercoaxinveigleseducediscrepancymesscompensationdemurrageforfeitindemnityquittanceretaliationconsequencepunishmentretributiondabmopseductiondecaymagicmiraclehumiliationinsultrepulsionfeigningpretentionevasion frictiongashhack
Idioms related to the meaning of chakma - چکما
What are the meanings of chakma - چکما in English?
Meanings of the word chakma - چکما in English are damage, hoax, beguilement, chacma, fraud, loss and trick. To understand how would you translate the word chakma - چکما in English, you can take help from words closely related to chakma - چکما or it’s English translations. Some of these words can also be considered chakma - چکما synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word chakma - چکما. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use chakma - چکما in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say chakma - چکما in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of chakma - چکما with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by چکما?
Meanings of چکما are damage, hoax, beguilement, chacma, fraud, loss and trick
Whats the definition of چکما?
Definition of the چکما are
- loss of military equipment
- the occurrence of a change for the worse
- the amount of money needed to purchase something
- inflict damage upon
- any harm or injury resulting from a violation of a legal right
- suffer or be susceptible to damage
- something intended to deceive; deliberate trickery intended to gain an advantage
- subject to a playful hoax or joke
- an entertainment that provokes pleased interest and distracts you from worries and vexations
- magnetic personal charm
- greyish baboon of southern and eastern Africa
- something intended to deceive; deliberate trickery intended to gain an advantage
- intentional deception resulting in injury to another person
- euphemistic expressions for death
- the disadvantage that results from losing something
- the act of losing someone or something
- the experience of losing a loved one
- military personnel lost by death or capture
- the amount by which the cost of a business exceeds its revenue
- something that is lost
- gradual decline in amount or activity
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
What is the synonym of چکما?
Synonym of word چکما are صدمہ, کاٹ, نقصان, ضرر, خسارہ, نقصان پہنچانا, ڈنڈ, کسر, چکما, ہرجانہ
What are the idioms related to چکما?
Here are the idioms that are related to the word چکما.
- It is a fraud to conceal a fraud
- A loss which is not known is not loss
- Loss of honour is loss of life
- Loss of wealth is lamented with greater outcry than the loss of friends
- Fraud is safe in no hiding place