Hiilah - حیلہ meanings in English
Hiilah - حیلہ meanings in English are guile, trick, trepan, quibble, fraud, feint, excuse, disguise, device, deception, subterfuge, sham, ruse, pretext, wile Hiilah - حیلہ in English. More meanings of hiilah - حیلہ, it's definitions, example sentences, related words, idioms and quotations.
guile trick trepan quibble fraud feint excuse disguise device deception subterfuge sham ruse pretext wile![]()
![]()
Hiilah - حیلہ Definitions
Please find 44 English and definitions related to the word Hiilah - حیلہ.
- (noun) : the act of concealing the identity of something by modifying its appearance
- (noun) : any attire that modifies the appearance in order to conceal the wearer's identity
- (noun) : an outward semblance that misrepresents the true nature of something
- (verb) : make unrecognizable
- (noun) : any distracting or deceptive maneuver (as a mock attack)
- (verb) : deceive by a mock action
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : the quality of being crafty
- (noun) : an artful or simulated semblance
- (noun) : something serving to conceal plans; a fictitious reason that is concocted in order to conceal the real reason
- (noun) : a deceptive maneuver (especially to avoid capture)
- (noun) : something intended to misrepresent the true nature of an activity
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : any clever maneuver
- (noun) : an instrumentality invented for a particular purpose
- (noun) : an emblematic design (especially in heraldry)
- (noun) : any ornamental pattern or design (as in embroidery)
- (noun) : something in an artistic work designed to achieve a particular effect
- (verb) : accept an excuse for
- (noun) : a defense of some offensive behavior or some failure to keep a promise etc.
- (verb) : ask for permission to be released from an engagement
- (noun) : a note explaining an absence
- (verb) : serve as a reason or cause or justification of
- (verb) : grant exemption or release to
- (verb) : excuse, overlook, or make allowances for; be lenient with
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (noun) : intentional deception resulting in injury to another person
- (verb) : argue over petty things
- (noun) : an evasion of the point of an argument by raising irrelevant distinctions or objections
- (verb) : evade the truth of a point or question by raising irrelevant objections
- (noun) : a drill for cutting circular holes around a center
- (noun) : a surgical instrument used to remove sections of bone from the skull
- (verb) : cut a hole with a trepan, as in surgery
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
More words related to the meanings of Hiilah - حیلہ
More words from English related to Hiilah - حیلہ
View an extensive list of words below that are related to the meanings of the word Hiilah - حیلہ meanings in English in English.
accursecausefashpretextaddictionailmentchargedefectdiseasefault flawbad habitillnessmotiveoccasionrubbishviceaddictednessactactiveactionverbdeedoperationpretenceworkverbenaverbosenessverbalsverberatesverbidverbidsverbsverismactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxiness ... fraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaffectationartificialityconstructionconcoctionconformationdispositionedificationequipmentfacefalsification feignfeint fictionfigmentforgingmakemanufacturenatureshamtextureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizesapologymakeshiftobjectionexcusepleaexculpatoryexcusableexcusablyexcusatoryexcusedexcuserexculpableexcusalexcusalsexcusersexcusingexcusiveexcoctexcusationexcuselessexcusementexcussionapostasydigressiondisobedience divergenceaberrationdeviationdivagationindirectnessinfractioninfringementobliquenessobliquityquibblerecantionvariationyawndefiancedeviancedeviationismdeviationistdevitalisationdevitalisedevitalizationdevolvementdefectionsdeflationsdejectionsdeviancesdevianciesdeviancydeviantsdeviatesdeviatingdeviationsdeviatordeviatorsdeviatorydevillingdisvaluedevaporationdevergencedevirginationdevitrificationdevocationdevorationimposturejugglerymachinationcircumventiondeceptionguilequackerypearlinesspreposterouscreationdeceitinstinctintriguesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitychouscross bitehoaxhypocrisyillusionjugglelegerdemaincheatingdeceivingdouble dealingfallowgriftliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationcheathuskartificialfalseimitativemockspuriousbastardboguscontriveddudfabricatedfactitiousfakepostichepseudorecordedshoddytraditionalunnaturalunorignalduplicitoussimulatedfacinorousimmingledimpingentmimeticalsimulantsimulantssimulatessimulatingsimulatorycentuplicatedduplicativereduplicativebandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbiddingdialect lingslanguagelinguaspeakspeechtonguebiddyboulleby bidcolloidalcoulissenaivenesspronkpuffyspokanebiddenbiddingsbidedbidingbidonbidonsbidsbrulyiebrulyiesbubbycolloquecolloquedcolloquescolloquiacolloquiescolloquisecolloquistnaivestnaivetiesoratorialoratorianswozzlesutterestbolyeboolycolliquamentcolloidalityslankspokedceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktracktrapbluffgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapedisloyaltybetrayaldouble crosswaterdiversion duplicityhoodwinkingsophistryburnsexpediencypolicystrategianstrategicsstrategiesstrategeticalstrategeticsstrategicircumlocutiondifferenceturningwindingcomedydramafunmimeryactingdisguise farceimitationimpersonationtravestyconcealconcealment eclipseimboskmantlemufflebefogblanketcoverensconcehidemaskobscurepalliatesmotherveilconcealingconcealsnidingcontentingaltercationargumentcontentioncontestdiscussion disputationhorse tradingquarrelhajjatcrampempalementencumbrancefenceguaranteehypothecationleeletmortgagemoundmunimentobstacleobstructionpullbackbarriercoveringdefenceinterventionmarrowpropprotectionscreenshadeshelteraarcrimeevasion ear ring minoroveraboveloftymadultrauponyoungsterbalasballowcureadvicearrangementartificedeliberationdeviceginopinionorderplangradualitymaneuverabilitymanoeuvrabilitytacticaltractarianismgradinetactualityplacitorystipulasustulatecurtaineyelidmembranemodestyprivacysecrecywallcurtainedpurdahblindscouvertcovertsveilingsveilydiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangecirclecoildilemmafoldmazemisfortunerevolutiontorsionturntwistdragsnarevertigoentrapmentgridlatchplexustoiltrepanwebreticulumjollreticulaentrammel entrapensnareensnaredimplicatevictimizeentangleinvolvealibisalvostalepretextergiversationdefermentdeferraldelaypostponementprevaricationfeigned fictitiousapocryphalfabulousforgedkitschphoneyfakeerfakerfakeryfalsiefalsifiablefalsifierfattishforficatephonydummyingfacsimiledfagaceousfaggotedfagotedfakedfakersfakesfakingfalsidicalfalsiesfalsifiedfalsifiersfalsifiesfaucialfordedforfairedforgetiveforjudgedspoofedcounterfeitedcounterfeitlyfalsaryfalsificatorfictiousforwakedfoutyimposturyhallucinationhumbuginsincerityquizfiguremannermodemodishnesspathwaytechniquebehaviourbreedingdemeanourguiselawmethodmodus operandistylewaythringchurlishfishing netmoneybaitbidconspiracycostdecoyloanpricevaluegrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloveplotrelationrelevancyloggegullhocuswheedlemake believevictimisehubrisassertionpresumptionpridevanitymischiefwickednessjoustjugglingsleightknaverydesidiousdesidiousnessknitwattlebecomegathergetpluckpretendselectstitchswankweavebecomingnessknishknitworkknitchesknittlelegalitylegalizationlegitimacyvaliditywarrantablenessjustificationproprietywarrantjustificatoryjusjustswelshmacrocosmallitrationepigramingenuityquirkskilluniversaluniversewitworldmixturesynthesistempercompositionconfigurationdecoctioninventionrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismcontrivancemanipulablemaniplesmanipularmanipulatedmanipulatingmanipulatorywaitinningopportunitymurderambushmaximphilosophysciencestalediplomacyknowledgewisenessmasqueradesseductiontemptationinstigationsnugnessblastblazeblowflameglowscentwarmthtergiversatebunkumfablefibfrivolous talkairscoquetryflirtingswaggerbeguilementdamagelosschacmacoaxinveigleseducediscrepancymessdabmopmagicmiraclefeigningpretentioneffortschememasqueradevisorvizardfrictiongashhackshow airs
Idioms related to the meaning of Hiilah - حیلہ
What are the meanings of Hiilah - حیلہ in English?
Meanings of the word Hiilah - حیلہ in English are disguise, feint, guile, pretext, ruse, sham, subterfuge, wile, deception, device, excuse, fraud, quibble, trepan and trick. To understand how would you translate the word Hiilah - حیلہ in English, you can take help from words closely related to Hiilah - حیلہ or it’s English translations. Some of these words can also be considered Hiilah - حیلہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Hiilah - حیلہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Hiilah - حیلہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Hiilah - حیلہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Hiilah - حیلہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by حیلہ?
Meanings of حیلہ are disguise, feint, guile, pretext, ruse, sham, subterfuge, wile, deception, device, excuse, fraud, quibble, trepan and trick
Whats the definition of حیلہ?
Definition of the حیلہ are
- the act of concealing the identity of something by modifying its appearance
- any attire that modifies the appearance in order to conceal the wearer's identity
- an outward semblance that misrepresents the true nature of something
- make unrecognizable
- any distracting or deceptive maneuver (as a mock attack)
- deceive by a mock action
- the use of tricks to deceive someone (usually to extract money from them)
- shrewdness as demonstrated by being skilled in deception
- the quality of being crafty
- an artful or simulated semblance
- something serving to conceal plans; a fictitious reason that is concocted in order to conceal the real reason
- a deceptive maneuver (especially to avoid capture)
- something intended to misrepresent the true nature of an activity
- the use of tricks to deceive someone (usually to extract money from them)
- an illusory feat; considered magical by naive observers
- the act of deceiving
- a misleading falsehood
- any clever maneuver
- an instrumentality invented for a particular purpose
- an emblematic design (especially in heraldry)
- any ornamental pattern or design (as in embroidery)
- something in an artistic work designed to achieve a particular effect
- accept an excuse for
- a defense of some offensive behavior or some failure to keep a promise etc.
- ask for permission to be released from an engagement
- a note explaining an absence
- serve as a reason or cause or justification of
- grant exemption or release to
- excuse, overlook, or make allowances for; be lenient with
- something intended to deceive; deliberate trickery intended to gain an advantage
- intentional deception resulting in injury to another person
- argue over petty things
- an evasion of the point of an argument by raising irrelevant distinctions or objections
- evade the truth of a point or question by raising irrelevant objections
- a drill for cutting circular holes around a center
- a surgical instrument used to remove sections of bone from the skull
- cut a hole with a trepan, as in surgery
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
What is the synonym of حیلہ?
Synonym of word حیلہ are تلبیس لباس کرنا, چھپانا, بہروپ رکھنا, بھيس بدلنا, شکل یا روپ بدلنا, سوانگ بھرنا, بہروپ, حیلہ, سوانگ, چھل
What are the idioms related to حیلہ?
Here are the idioms that are related to the word حیلہ.
- It is a fraud to conceal a fraud
- A slight pretext suffices for doing evil
- Fraud is safe in no hiding place
- It is a fraud to accept what you cannot repay
- One trick needs a great many more to make it good
