تھریڈر - Threader meanings in English

تھریڈر - Threader meanings in English are cleverness, fraud, trick تھریڈر - Threader in English. More meanings of تھریڈر - threader, it's definitions, example sentences, related words, idioms and quotations.

cleverness fraud trick

Install chrome extension

تھریڈر - Threader Definitions

Please find 12 English and definitions related to the word تھریڈر - Threader.

  • (noun) : intelligence as manifested in being quick and witty
  • (noun) : the property of being ingenious
  • (noun) : the power of creative imagination
  • (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
  • (noun) : intentional deception resulting in injury to another person
  • (noun) : an illusory feat; considered magical by naive observers
  • (verb) : deceive somebody
  • (noun) : a prostitute's customer
  • (noun) : a cunning or deceitful action or device
  • (noun) : an attempt to get you to do something foolish or imprudent
  • (noun) : a period of work or duty
  • (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner

More words from English related to تھریڈر - Threader

View an extensive list of words below that are related to the meanings of the word تھریڈر - Threader meanings in English in English.

acerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpeditenessrapacesfastartfulnessmanoeuvrepromptitudequirkinessrusesliness ...

What are the meanings of تھریڈر - Threader in English?

Meanings of the word تھریڈر - Threader in English are cleverness, fraud and trick. To understand how would you translate the word تھریڈر - Threader in English, you can take help from words closely related to تھریڈر - Threader or it’s English translations. Some of these words can also be considered تھریڈر - Threader synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word تھریڈر - Threader. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use تھریڈر - Threader in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say تھریڈر - Threader in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of تھریڈر - Threader with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by Threader?

Meanings of Threader are cleverness, fraud and trick

Whats the definition of Threader?

Definition of the Threader are

  • intelligence as manifested in being quick and witty
  • the property of being ingenious
  • the power of creative imagination
  • something intended to deceive; deliberate trickery intended to gain an advantage
  • intentional deception resulting in injury to another person
  • an illusory feat; considered magical by naive observers
  • deceive somebody
  • a prostitute's customer
  • a cunning or deceitful action or device
  • an attempt to get you to do something foolish or imprudent
  • a period of work or duty
  • (card games) in a single round, the sequence of cards played by all the players; the high card is the winner

What is the synonym of Threader?

Synonym of word Threader are چالاکی, حکمت, ہوشیاری, کاری گری, پچیتی, تیزی, چکما, چرکا, چھل, ڈھونگ

What are the idioms related to Threader?

Here are the idioms that are related to the word Threader.

  • Cleverness seeks cleverness
  • It is a fraud to conceal a fraud
  • Fraud is safe in no hiding place
  • It is a fraud to accept what you cannot repay
  • One trick needs a great many more to make it good