Matas - متس meanings in English
Matas - متس meanings in English is fish Matas - متس in English. More meanings of matas - متس, it's definitions, example sentences, related words, idioms and quotations.
Matas - متس Definitions
Please find 7 English and definitions related to the word Matas - متس.
- (noun) : any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- (noun) : the flesh of fish used as food
- (noun) : (astrology) a person who is born while the sun is in Pisces
- (noun) : the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- (verb) : catch or try to catch fish or shellfish
- (verb) : seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
More words related to the meanings of Matas - متس
Fish | بنسی کھیلنا مچھلی کا شکار کرنا ڈگن مارنا مچھلی machhli مچھلی machli مچھی مین Meen متس Matas ماہی maahi ماہی Mahi جل تری مچھلی کا گوشت ماس مچھلی مچھلی پکڑنا machhli pakarna |
More words from English related to Matas - متس
View an extensive list of words below that are related to the meanings of the word Matas - متس meanings in English in English.
fishmusclealligator pearalligatorfishcrampfishfiscfisheyefishwifelobe finned fishmay fishpiscatorypiscinestill fishsweetbriarbeeswingcramponscrocketscrocoisitecubsfiscalsfiscsfishablefishedfishinessfisksfistianamishmashespiscariespisciformpiskiespissoirssweetfishbearishnesscich peafleshquakefriesishpiscationpiscinalpiscesmainejack tarpiscicapture
Idioms related to the meaning of Matas - متس
What are the meanings of Matas - متس in English?
Meanings of the word Matas - متس in English is fish. To understand how would you translate the word Matas - متس in English, you can take help from words closely related to Matas - متس or it’s English translations. Some of these words can also be considered Matas - متس synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Matas - متس. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Matas - متس in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Matas - متس in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Matas - متس with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by matas?
Meaning of matas is fish
Whats the definition of matas?
Definition of the matas are
- any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- the flesh of fish used as food
- (astrology) a person who is born while the sun is in Pisces
- the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- catch or try to catch fish or shellfish
- seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
What is the synonym of matas?
Synonym of word matas are بنسی کھیلنا, مچھلی کا شکار کرنا, ڈگن مارنا, مچھلی, مچھی, مین, متس, ماہی, جل تری, مچھلی کا گوشت
What are the idioms related to matas?
Here are the idioms that are related to the word matas.
- A fish out of water
- All fish are not caught with flies
- All is fish that comes to his net
- Better small fish than an empty dish
- Daughters and dead fish are not keeping wares