Murakkib - مرکب meanings in English
Murakkib - مرکب meanings in English are complex, composedly, compositional, compounding, blends, compluvium, composites, confix, immixture, mixt, mixtion, mixtions, mixtures, comburant, admixture, horse, mixed, multiple, multiplex, vehicle, combination, compound, compounded, ink, mix, ship, vessel, compagination Murakkib - مرکب in English. More meanings of murakkib - مرکب, it's definitions, example sentences, related words, idioms and quotations.
complex composedly compositional compounding blends compluvium composites confix immixture mixt mixtion mixtions mixtures comburant admixture horse mixed multiple multiplex vehicle combination compound compounded ink mix ship vessel compagination
Murakkib - مرکب Definitions
Please find 58 English and 2 Urdu definitions related to the word Murakkab - مرکب.
- (noun) : a conceptual whole made up of complicated and related parts
- (noun) : (psychoanalysis) a combination of emotions and impulses that have been rejected from awareness but still influence a person's behavior
- (noun) : a compound described in terms of the central atom to which other atoms are bound or coordinated
- (noun) : a whole structure (as a building) made up of interconnected or related structures
- (adjective) : complicated in structure; consisting of interconnected parts
- (adjective satellite) : difficult to analyze or understand
- (noun) : the act of combining things to form a new whole
- (noun) : the act of arranging elements into specified groups without regard to order
- (noun) : a collection of things that have been combined; an assemblage of separate parts or qualities
- (noun) : an alliance of people or corporations or countries for a special purpose (formerly to achieve some antisocial end but now for general political or economic purposes)
- (noun) : a group of people (often temporary) having a common purpose
- (noun) : a sequence of numbers or letters that opens a combination lock
- (noun) : a coordinated sequence of chess moves
- (adjective) : composed of more than one part
- (noun) : solid-hoofed herbivorous quadruped domesticated since prehistoric times
- (noun) : a padded gymnastic apparatus on legs
- (noun) : a framework for holding wood that is being sawed
- (verb) : provide with a horse or horses
- (noun) : a chessman shaped to resemble the head of a horse; can move two squares horizontally and one vertically (or vice versa)
- (verb) : to bring or combine together or with something else
- (noun) : the act of mixing together
- (noun) : an event that combines things in a mixture
- (noun) : a commercially prepared mixture of dry ingredients
- (verb) : add as an additional element or part
- (verb) : open (a place) to members of all races and ethnic groups
- (verb) : combine (electronic signals)
- (adjective satellite) : involving or composed of different races
- (adjective satellite) : consisting of a haphazard assortment of different kinds
- (noun) : the product of a quantity by an integer
- (adjective) : having or involving or consisting of more than one part or entity or individual
- (noun) : communicates two or more signals over a common channel
- (adjective satellite) : having many parts or aspects
- (noun) : a movie theater than has several different auditoriums in the same building
- (noun) : a conveyance that transports people or objects
- (noun) : a medium for the expression or achievement of something
- (noun) : any inanimate object (as a towel or money or clothing or dishes or books or toys etc.) that can transmit infectious agents from one person to another
- (noun) : any substance that facilitates the use of a drug or pigment or other material that is mixed with it
- (noun) : a craft designed for water transportation
- (noun) : an object used as a container (especially for liquids)
- (noun) : the act of mixing together
- (noun) : an additional ingredient that is added by mixing with the base
- (noun) : the state of impairing the quality or reducing the value of something
- (adjective satellite) : supporting combustion
- (adverb) : in a self-collected or self-possessed manner
- (adjective satellite) : arranging or grouping
- (adjective satellite) : combined into or constituting a chemical compound
- (noun) : the act of combining things to form a new whole
- (noun) : dark protective fluid ejected into the water by cuttlefish and other cephalopods
- (noun) : a liquid used for printing or writing or drawing
- (verb) : fill with ink
- (verb) : append one's signature to
- (verb) : mark, coat, cover, or stain with ink
- (verb) : go on board
- (verb) : transport commercially
- (noun) : a vessel that carries passengers or freight
- (verb) : place on board a ship
- (verb) : travel by ship
- (verb) : hire for work on a ship
- دو یا زیادہ عناصَر کا ایسے مِلنا کہ کوئی نَئی شے بَن جائے
- کِسی چیز کو ایک جگہ سے دُوسری جگہ لے جانے کا کوئی ذریعہ جیسے پہیوں پر
More words from English related to Murakkab - مرکب
View an extensive list of words below that are related to the meanings of the word Murakkib - مرکب meanings in English in English.
accordblenchchafedco operatecomportconcurcongregatecorrespondentcoupleconnectfindfretgaingetgreetkneadknitleaguemashminglemixoccurquadratetallyclubcombineconsistintroducejoinmeetobtainconfreremeetnessaffixappendblendcementcompareekeembodyidentifyidentifiesimmiximplicatejointjumblelinklikenlumptack ... temperadjoincollateinductintermingleintermixmeldinviscatingencloseenlistannexconcludeencompassincludeincorporateadducinginvolucrateaddingincoronateincorporatingaffluxagreeablenessagreementco operationconcurrenceconfluenceconformityconsonanacecontiguitycombinationcoalitionsdirtfellowship grimejunctionliaisonmilemindednessmixturesymmetrytendencyaffiliationamitycoincidencedirtinessdrossfilthfriendshipharmonyinducementmatchpropensitysullageunitymailemelmilesagencyapplianceinstrumentalityintermediaryinterpositioninterventionmeansmediationresourcesupportvehiclewayargomanualscrap bookmboatshipvesselsaphenabasinutensilkitvasepotdishpanpotationpottlecoshescossesdishesdishfulspotchpotchespotespotichespotlatchespottpottingpottsvesselsvesselfulscapacitycontainercapabilitycontentquartbillowemotionhorsevagarywar horsewavewhimcapriceconceitcrankcrotchetfreakimpulsewhimsytaringdissolveemaciatedisolvelanguishsolubilizecanopuspinnacecartcarchariotwagonautomobilecarriagecoachshebangtrainmotor vehiclevehicledvehiculatevehiculationvehmicclimbenhance mountoutflyoverswellascendcloakexcelincreaseriderisescalesoarascenderclimbingcliffygridingcoherentmixedcomposedcontiguousjoinednextvicinalcomminglecomplexconsigndespatchdispatchsenddepichedispacedispacingdispenddispondeeremitteeremittingdismaildispatchingcompoundhybridmiscellaneousblendedcross breedhalf bredhotchpotchmingledmishmashmixed upcrazinessimbecilitymultipleslendernessatonydebilityfeeblenessfrailtyinfirmityweaknesscumulativenumerousseveralvariousmanypolymathybounteousmultipotentmultiracialmultistoriedpolonypolyandrouspolydactylouspolydactylypolyestrouspolygonalpolymorphouspolynomialpolyoestrouspolyoicouspolypetalouspolyphonicallypolyphonouspolysemouspolyunsaturatedpolyvalentroly polyseveralisemutualizespolypolycroticpolygamicpolymastypolyonymicpolyonymypolypouspolytocousseveralsvarietallymultiloquentmultinodousmultinominousmultinucleatedmultisciousmultisiliquousmultisonousmultisyllableparenchymousplacentiousplurifariouspollenariouspoltroonishpolyglottouspolylogypolyloquentpolymeniscouspolymyodouspolyommatouspolyonomouspolyonymouspolyparouspolyrhizouspolythalamouspolytheisticalpolytomousrurigenousseveralitiesstultiloquentcupbowlcereclothpurlicuevitreositydaubdrabbletaintbedaubdefileinvolvemoilsmeardarknessblacknessinkinkinessnigrescencestigmainkedinkinginklingsinksdissimilar distinct diversedifferentdiscrepantvariantincongruousotherunlikevarieddifferentiallydiffusivediscantdivergencyvarmentvaryingdiffereddifferingdifformdiffracteddiffractsdisparatesdivertibledivestiblevariatingvarifocalvariscitevarsitiesdiffinediffinitivediffractiveeaglefalconidae plfalconopenagaindoerhawkrefusingequinesteedhobblerhorse brierhorsefleshhorsehairhorsepondhorseweedhorsehairshorseyhorse drenchhorse leechhorselikefurrowgrocerymaterialspice upspicedspicingspiledcommingledjointedmanifoldtabbymanoeuvrableceruseddiswittedimmutemonomachyshalloopwherryarksalvertraywrestlingplanetesimalspacialwrestingwrestledwrestlingsboatageboationmultiplexnerveveinblood vesselfibresinewrgwrigpassengerconveyancegestationhorsemanshipriderride offsouarirideableridessowarryswervingsswinestypitcherwater pitcherwater potjarturnaroundsailplanespaceshipshipfulsshiplapshiplappedshipsshipletshirlsipagecomplicatedentangledknotmedleylightlightning
Idioms related to the meaning of Murakkib - مرکب
What are the meanings of Murakkib - مرکب in English?
Meanings of the word Murakkib - مرکب in English are . To understand how would you translate the word Murakkib - مرکب in English, you can take help from words closely related to Murakkib - مرکب or it’s English translations. Some of these words can also be considered Murakkib - مرکب synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Murakkib - مرکب. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Murakkib - مرکب in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Murakkib - مرکب in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Murakkib - مرکب with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by murakkib?
complex, composedly, compositional, compounding, blends, compluvium, composites, confix, immixture, mixt, mixtion, mixtions, mixtures, comburant, admixture, horse, mixed, multiple, multiplex, vehicle, combination, compound, compounded, ink, mix, ship, vessel, compagination
Whats the definition of murakkib?
Definition of the murakkib are
- a conceptual whole made up of complicated and related parts
- (psychoanalysis) a combination of emotions and impulses that have been rejected from awareness but still influence a person's behavior
- a compound described in terms of the central atom to which other atoms are bound or coordinated
- a whole structure (as a building) made up of interconnected or related structures
- complicated in structure; consisting of interconnected parts
- difficult to analyze or understand
- the act of combining things to form a new whole
- the act of arranging elements into specified groups without regard to order
- a collection of things that have been combined; an assemblage of separate parts or qualities
- an alliance of people or corporations or countries for a special purpose (formerly to achieve some antisocial end but now for general political or economic purposes)
- a group of people (often temporary) having a common purpose
- a sequence of numbers or letters that opens a combination lock
- a coordinated sequence of chess moves
- composed of more than one part
- solid-hoofed herbivorous quadruped domesticated since prehistoric times
- a padded gymnastic apparatus on legs
- a framework for holding wood that is being sawed
- provide with a horse or horses
- a chessman shaped to resemble the head of a horse; can move two squares horizontally and one vertically (or vice versa)
- to bring or combine together or with something else
- the act of mixing together
- an event that combines things in a mixture
- a commercially prepared mixture of dry ingredients
- add as an additional element or part
- open (a place) to members of all races and ethnic groups
- combine (electronic signals)
- involving or composed of different races
- consisting of a haphazard assortment of different kinds
- the product of a quantity by an integer
- having or involving or consisting of more than one part or entity or individual
- communicates two or more signals over a common channel
- having many parts or aspects
- a movie theater than has several different auditoriums in the same building
- a conveyance that transports people or objects
- a medium for the expression or achievement of something
- any inanimate object (as a towel or money or clothing or dishes or books or toys etc.) that can transmit infectious agents from one person to another
- any substance that facilitates the use of a drug or pigment or other material that is mixed with it
- a craft designed for water transportation
- an object used as a container (especially for liquids)
- the act of mixing together
- an additional ingredient that is added by mixing with the base
- the state of impairing the quality or reducing the value of something
- supporting combustion
- in a self-collected or self-possessed manner
- arranging or grouping
- combined into or constituting a chemical compound
- the act of combining things to form a new whole
- dark protective fluid ejected into the water by cuttlefish and other cephalopods
- a liquid used for printing or writing or drawing
- fill with ink
- append one's signature to
- mark, coat, cover, or stain with ink
- go on board
- transport commercially
- a vessel that carries passengers or freight
- place on board a ship
- travel by ship
- hire for work on a ship
- دو یا زیادہ عناصَر کا ایسے مِلنا کہ کوئی نَئی شے بَن جائے
- کِسی چیز کو ایک جگہ سے دُوسری جگہ لے جانے کا کوئی ذریعہ جیسے پہیوں پر
What is the synonym of murakkib?
Synonym of word murakkib are مرکب, سنجُکت, پیچیدہ بات, میل, اِتصَال, اِتّحَاد, مِلانے کا عمَل, مُرَکَّب, ترنگ, چڑھنا
What are the idioms related to murakkib?
Here are the idioms that are related to the word murakkib.
- Good things are mixed with evil evil things with good
- Oedipus complex
- Who does not mix with the crowd knows nothing
- Pen and ink
- Sympathetic ink