Pawon - پاؤں meanings in English
Pawon - پاؤں meanings in English are foot, outfoots, outfoot, footworn, footsie, foots, footrules, footrule, footpads, footlings, footings, footholds, foetor, step, leg, gait, feet Pawon - پاؤں in English. More meanings of pawon - پاؤں, it's definitions, example sentences, related words, idioms and quotations.
foot outfoots outfoot footworn footsie foots footrules footrule footpads footlings footings footholds foetor step leg gait feet foot
Pawon - پاؤں Definitions
Please find 33 English and 2 Urdu definitions related to the word Pawon - پاؤں.
- (noun) : the pedal extremity of vertebrates other than human beings
- (noun) : travel by walking
- (noun) : the part of the leg of a human being below the ankle joint
- (noun) : (prosody) a group of 2 or 3 syllables forming the basic unit of poetic rhythm
- (noun) : a person's manner of walking
- (noun) : a horse's manner of moving
- (noun) : (nautical) the distance traveled by a sailing vessel on a single tack
- (noun) : one of the supports for a piece of furniture
- (noun) : a structure in animals that is similar to a human leg and used for locomotion
- (noun) : the limb of an animal used for food
- (noun) : a section or portion of a journey or course
- (noun) : a prosthesis that replaces a missing leg
- (noun) : a cloth covering consisting of the part of a pair of trousers that covers a person's leg
- (noun) : a human limb; commonly used to refer to a whole limb but technically only the part of the limb between the knee and ankle
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : a distinctive odor that is offensively unpleasant
- ٹانگ کا ٹَخنے کے نیچےوالاحِصّہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words related to the meanings of Pawon - پاؤں
More words from English related to Pawon - پاؤں
View an extensive list of words below that are related to the meanings of the word Pawon - پاؤں meanings in English in English.
abutmentgradepierrundlecantileverfoundation honourlegstatusagedcasuistfootfoot markmondaydevoteedisciplefollowerfootstephierarcholdvotaryfootednessfootingforefootmonparrtoe intoetoefootboymondainperetoeingpyr axistarsustrunkshankceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfuge ... activityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcoachmarchroutedepartureegressexodusjourneycoachwhipkocharmlocksarmorsarmurearmurescoachycruxdifficultyinnstagedispatchgoingleavesmoothnesscoursingdepartercoursingsdepartersdepartingsdepartsdeparturesdepartableemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentfoot pacefootfallmeasurepacestridesteedsstetsyardverseversiclepeagpugpiggp.a.pabetreaddisembarksteppingtrampletrampledjamtramplingtramplingstempovelocityspeedinesspacesspeansspeedsspeedstersvelocitiesspecesperagekickenvenimeleggeleggerlegginesslegistthighsuppressionmeasuresInitiativespromenadetenortrackhabithabitudewayfuriesfittfittefittesfittsfootledfettefit to
Idioms related to the meaning of Pawon - پاؤں
What are the meanings of Pawon - پاؤں in English?
Meanings of the word Pawon - پاؤں in English are foot, gait, leg, step, foetor, feet, footholds, footings, footlings, footpads, footrule, footrules, foots, footsie, footworn, outfoot and outfoots. To understand how would you translate the word Pawon - پاؤں in English, you can take help from words closely related to Pawon - پاؤں or it’s English translations. Some of these words can also be considered Pawon - پاؤں synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Pawon - پاؤں. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Pawon - پاؤں in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Pawon - پاؤں in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Pawon - پاؤں with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by pawon?
Meanings of pawon are foot, gait, leg, step, foetor, feet, footholds, footings, footlings, footpads, footrule, footrules, foots, footsie, footworn, outfoot and outfoots
Whats the definition of pawon?
Definition of the pawon are
- the pedal extremity of vertebrates other than human beings
- travel by walking
- the part of the leg of a human being below the ankle joint
- (prosody) a group of 2 or 3 syllables forming the basic unit of poetic rhythm
- a person's manner of walking
- a horse's manner of moving
- (nautical) the distance traveled by a sailing vessel on a single tack
- one of the supports for a piece of furniture
- a structure in animals that is similar to a human leg and used for locomotion
- the limb of an animal used for food
- a section or portion of a journey or course
- a prosthesis that replaces a missing leg
- a cloth covering consisting of the part of a pair of trousers that covers a person's leg
- a human limb; commonly used to refer to a whole limb but technically only the part of the limb between the knee and ankle
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- a distinctive odor that is offensively unpleasant
- ٹانگ کا ٹَخنے کے نیچےوالاحِصّہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of pawon?
Synonym of word pawon are پیر, پاؤں, قدم, چرن, پگ, پا, پاوں, پَیر, پاؤں رکھنا, قدم رکھنا
What are the idioms related to pawon?
Here are the idioms that are related to the word pawon.
- Step after step the ladder is ascended
- Step by step one goes far
- Change the leg
- Ln high leg
- Pull one leg