Tay - تہ meanings in English
Tay - تہ Definitions
Please find 46 English and 2 Urdu definitions related to the word Tay - تہ.
- (noun) : a medium that disseminates moving pictures
- (verb) : make a film or photograph of something
- (noun) : a thin coating or layer
- (noun) : a thin sheet of (usually plastic and usually transparent) material used to wrap or cover things
- (noun) : a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
- (verb) : record in film
- (noun) : photographic material consisting of a base of celluloid covered with a photographic emulsion; used to make negatives or transparencies
- (noun) : a small fragment of something broken off from the whole
- (noun) : a person with an unusual or odd personality
- (noun) : a crystal of snow
- (verb) : come off in flakes or thin small pieces
- (verb) : cover with flakes or as if with flakes
- (verb) : form into flakes
- (noun) : a lower limit
- (verb) : knock down with force
- (noun) : the legislative hall where members debate and vote and conduct other business
- (noun) : the parliamentary right to address an assembly
- (noun) : the occupants of a floor
- (noun) : the ground on which people and animals move about
- (noun) : a structure consisting of a room or set of rooms at a single position along a vertical scale
- (noun) : a large room in a exchange where the trading is done
- (noun) : the bottom surface of any lake or other body of water
- (noun) : the lower inside surface of any hollow structure
- (noun) : the inside lower horizontal surface (as of a room, hallway, tent, or other structure)
- (verb) : cease to operate or cause to cease operating
- (noun) : a group of people who adhere to a common faith and habitually attend a given church
- (noun) : an angular or rounded shape made by folding
- (noun) : a group of sheep or goats
- (noun) : the act of folding
- (noun) : a pen for sheep
- (verb) : incorporate a food ingredient into a mixture by repeatedly turning it over without stirring or beating
- (verb) : become folded or folded up
- (verb) : bend or lay so that one part covers the other
- (verb) : confine in a fold, like sheep
- (noun) : a folded part (as in skin or muscle)
- (noun) : a geological process that causes a bend in a stratum of rock
- (verb) : assemble or get together
- (verb) : collect in one place
- (noun) : the act of gathering something
- (noun) : sewing consisting of small folds or puckers made by pulling tight a thread in a line of stitching
- (verb) : conclude from evidence
- (verb) : look for (food) in nature
- (verb) : get people together
- (verb) : increase or develop
- (verb) : draw together into folds or puckers
- (verb) : draw and bring closer
- وہ پوست جو ڈوڈے کے اندر صرف بیجوں پر ہوتا ہے
- جِس کا نظر آنا ضروری نہیں ہے
Example Sentence
Labor day is to pays tribute to the greatest worker in the world, awarding time off with lively parades and festivals. | یوم مزدور دنیا کے سب سے بڑے کارکن کو خراج تحسین پیش کرنا ہے ، جس میں رواں پریڈوں اور تہواروں کے ساتھ وقت دیا جاتا ہے |
More words related to the meanings of Tay - تہ
More words from English related to Tay - تہ
View an extensive list of words below that are related to the meanings of the word Tay - تہ meanings in English in English.
accumulatecongregategathergroupjoinlumpgarneringatheringagglomeratinghoardingathersweepaggregatecollectionekefundmobilizestoreamassbunchcollecttotacculturationagglutinatecollectivisecollectivizepluralizerepositaccruingaggrateamassingassegaiingcomportingconglobingcongreeingdepositingaccumulatingaggregatingasseveratingcollectednesscolorateconcubinatepluralizingfeedplenishprovidepurveyimpartingimparkproviding ... acridbasketepidermis filmhymenmembraneveilwebmemberedmembralimbuementmembraniformaffixbucklecalculatecementcomputecombineconnectcomposeconjoinconnectsembodyfeignhooklinkmortisepieceputtysplicetacktapewaferaddannexappendattachconjugateinosculateinterconnectinventknitpatchuniteadductingaddlingappendingconjoiningensembleslinkingenlinksejunctioncolligatebatchclustercongestcumulateherdmusteracclimateacclivitousamalgamativeacciteacclivousaccoastsaccoilconcoctinggarneringmusteringunbrokeunkennelacclimatizingaccompliceshipconciteappositionconcurconfederatecopulateenrootinfixinlayknotstudrattlesnake rootinlayingsrootednessstuddingstuddlestudsinertioninherseareafloor planesurfacelevelscleavefoul cuddleembraceentanglefoldhugintertwineintertwinedsmugglewrapclassorderrankstoreystratumtierstrataconfute foiloutfacebeatconfoundcounteractdefeatdiscomfitlickoutclassoutdooutgunwhompwhopwhupconvenemobbingcongressmeetacculturationalcongruousnessgatlingconstrictroll upwindringwindrowingcruxentanglementgruelimplexionimplicationkinkwater gruelcoilcomplicationconjeecurlcurvedeceitdifficultyindirectnessintorsionnullscrewslewtorsiontwistvolutionwimplepaschpatchedpatchingpatchoulyschlockscrewingbachingleachesmatchetspatchespatchingspatchworkspaunchespechpechsperchingpleuchscreaksscreechesscreichscreighscrewerscrewingsscrewsscrowsscutchscutchesspewstachesboltdiversion circledifferencedilemmamazemisfortunerevolutiontrickturnwindingyawndisk flakecrustlayerregiontrayworldearth geoglobegroundimmovableestatelandsoilterrafacetprioritybeginningcommencementprecedenceinitialedinitialledeffrontitsheetcardfolioleafpaperfoilingsfoilsforaneflap jackincrustationrindscurfencrustationlaminaplightplyshellcrustationdabcarpetmatpavementflooredflooringfloorerfloorersflooringsfloorsflooragefluorfloursabodedestinationflat goalgreejourneyday's journeylandinglevelmansionobjectivetrekflakforgatheramalgamateamalgamatingfracturepuckersrumplecreasepleatruckruffleclubwattlebecomegetpluckpretendselectshamstitchswankweavebecomingnessknishknitworkknitchesknittleyokingsamalgamizetabfoldawayfoldagelaynerexploitharryhentplunderpullsnatchtearfakeinvaginate
Idioms related to the meaning of Tay - تہ
What are the meanings of Tay - تہ in English?
Meanings of the word Tay - تہ in English are film, flake, floor, fold and gather. To understand how would you translate the word Tay - تہ in English, you can take help from words closely related to Tay - تہ or it’s English translations. Some of these words can also be considered Tay - تہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Tay - تہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Tay - تہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Tay - تہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Tay - تہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by tay?
Meanings of tay are film, flake, floor, fold and gather
Whats the definition of tay?
Definition of the tay are
- a medium that disseminates moving pictures
- make a film or photograph of something
- a thin coating or layer
- a thin sheet of (usually plastic and usually transparent) material used to wrap or cover things
- a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
- record in film
- photographic material consisting of a base of celluloid covered with a photographic emulsion; used to make negatives or transparencies
- a small fragment of something broken off from the whole
- a person with an unusual or odd personality
- a crystal of snow
- come off in flakes or thin small pieces
- cover with flakes or as if with flakes
- form into flakes
- a lower limit
- knock down with force
- the legislative hall where members debate and vote and conduct other business
- the parliamentary right to address an assembly
- the occupants of a floor
- the ground on which people and animals move about
- a structure consisting of a room or set of rooms at a single position along a vertical scale
- a large room in a exchange where the trading is done
- the bottom surface of any lake or other body of water
- the lower inside surface of any hollow structure
- the inside lower horizontal surface (as of a room, hallway, tent, or other structure)
- cease to operate or cause to cease operating
- a group of people who adhere to a common faith and habitually attend a given church
- an angular or rounded shape made by folding
- a group of sheep or goats
- the act of folding
- a pen for sheep
- incorporate a food ingredient into a mixture by repeatedly turning it over without stirring or beating
- become folded or folded up
- bend or lay so that one part covers the other
- confine in a fold, like sheep
- a folded part (as in skin or muscle)
- a geological process that causes a bend in a stratum of rock
- assemble or get together
- collect in one place
- the act of gathering something
- sewing consisting of small folds or puckers made by pulling tight a thread in a line of stitching
- conclude from evidence
- look for (food) in nature
- get people together
- increase or develop
- draw together into folds or puckers
- draw and bring closer
- وہ پوست جو ڈوڈے کے اندر صرف بیجوں پر ہوتا ہے
- جِس کا نظر آنا ضروری نہیں ہے
What is the synonym of tay?
Synonym of word tay are جھلی, جالا, جِھلی, تہ, ورق, باریک جھلی, باریک پرت, طبق, پہل, پاپڑ
What are the idioms related to tay?
Here are the idioms that are related to the word tay.
- There is a black sheep in every fold
- Gather ground
- Gather thistles expect pickles
- Gather to a head
- Standing pools gather filth
How to use tay in a sentence?
Here are few examples on how to use tay in a sentence.
- Labor day is to pays tribute to the greatest worker in the world, awarding time off with lively parades and festivals. — یوم مزدور دنیا کے سب سے بڑے کارکن کو خراج تحسین پیش کرنا ہے ، جس میں رواں پریڈوں اور تہواروں کے ساتھ وقت دیا جاتا ہے