Badlaa - بدلہ meanings in English
Badlaa - بدلہ meanings in English are compensation, vengeance, wage, avengement, avenges, avenses, retributed, retributes, revenges, avenage, recompensement, revenge, retribution, lieu, wages, exchange, in exchange for, interchange, payment, replacement, requital, retaliation, retort, revengement Badlaa - بدلہ in English. More meanings of badlaa - بدلہ, it's definitions, example sentences, related words, idioms and quotations.
compensation vengeance wage avengement avenges avenses retributed retributes revenges avenage recompensement revenge retribution lieu wages exchange in exchange for interchange payment replacement requital retaliation retort revengement
Badlaa - بدلہ Definitions
Please find 52 English and definitions related to the word Badlaa - بدلہ.
- (noun) : something (such as money) given or received as payment or reparation (as for a service or loss or injury)
- (noun) : (psychiatry) a defense mechanism that conceals your undesirable shortcomings by exaggerating desirable behaviors
- (noun) : the act of compensating for service or loss or injury
- (noun) : the post or function properly or customarily occupied or served by another
- (noun) : the act of taking revenge (harming someone in retaliation for something harmful that they have done) especially in the next life
- (noun) : something that remunerates
- (verb) : carry on (wars, battles, or campaigns)
- (noun) : a recompense for worthy acts or retribution for wrongdoing
- (noun) : a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication
- (verb) : exchange or replace with another, usually of the same kind or category
- (verb) : give to, and receive from, one another
- (verb) : exchange a penalty for a less severe one
- (noun) : (sports) an unbroken sequence of several successive strokes
- (noun) : (chess) the capture by both players (usually on consecutive moves) of pieces of equal value
- (noun) : (chess) gaining (or losing) a rook in return for a knight or bishop
- (noun) : reciprocal transfer of equivalent sums of money (especially the currencies of different countries)
- (noun) : the act of giving something in return for something received
- (noun) : the act of changing one thing for another thing
- (noun) : a mutual expression of views (especially an unpleasant one)
- (noun) : chemical process in which one atom or ion or group changes places with another
- (noun) : the act of putting one thing or person in the place of another:
- (noun) : a workplace for buying and selling; open only to members
- (verb) : change over, change around, as to a new order or sequence
- (verb) : put in the place of another; switch seemingly equivalent items
- (verb) : hand over one and receive another, approximately equivalent
- (verb) : give to, and receive from, one another
- (verb) : cause to change places
- (noun) : reciprocal transfer of equivalent sums of money (especially the currencies of different countries)
- (noun) : the act of changing one thing for another thing
- (noun) : a junction of highways on different levels that permits traffic to move from one to another without crossing traffic streams
- (verb) : put in the place of another; switch seemingly equivalent items
- (noun) : mutual interaction; the activity of reciprocating or exchanging (especially information)
- (noun) : the act of paying money
- (noun) : a sum of money paid or a claim discharged
- (noun) : an act of requiting; returning in kind
- (noun) : a person who follows next in order
- (noun) : someone who takes the place of another person
- (noun) : an event in which one thing is substituted for another
- (noun) : the act of furnishing an equivalent person or thing in the place of another
- (noun) : a person or thing that takes or can take the place of another
- (noun) : filling again by supplying what has been used up
- (noun) : a justly deserved penalty
- (noun) : an act of requiting; returning in kind
- (noun) : action taken in return for an injury or offense
- (noun) : a quick reply to a question or remark (especially a witty or critical one)
- (verb) : answer back
- (noun) : a vessel where substances are distilled or decomposed by heat
- (noun) : the act of taking revenge (harming someone in retaliation for something harmful that they have done) especially in the next life
- (noun) : the act of correcting for your wrongdoing
- (noun) : a justly deserved penalty
- (verb) : take revenge for a perceived wrong
- (noun) : action taken in return for an injury or offense
More words related to the meanings of Badlaa - بدلہ
More words from English related to Badlaa - بدلہ
View an extensive list of words below that are related to the meanings of the word Badlaa - بدلہ meanings in English in English.
accommodationcapacitylieusitevicinitywhereaboutabouthabitationlocalitylocusnounplaceroomspacevacancyin placerepositionplacetafflictionfuryvengeancecalamitywrathwrathinessavengerequiteretaliaterevengevengeavengeancebalkanizationdispensationdistinctiondistributiondivisionpartitionpaymentrepartitionsharingapportionedapportionmentcompartmenteddistributeddistributionaldistributivelydivisibilitydivisiblepartitioningsplintsplitsaw ... splitsvillesplittingdispensesdissembleddivdividingsdividividividualdividuousdiviesdivinizesdivisionsdivvyingdivyingspliffssplintwoodsplitsapportionatenessdistributivenesspartitionmentchangeconvertcommutediversifyvariateveeralterexchangeinterchangereplacetransformtransposeturnvibratemutatereplantingintervertficklemodifyamendprocessreplacingconvertingcommonfang femalegrudgehostilityjujubewaranimosityanimusantagonismdespiteenmityill willinimicalitymalevolencemalicemalignitybarrebermsberriescompensationcounter buffoverturnflightrequitalretaliationretreatreturnreverserevertrevolutionslewthrow backvolte facepayersatzinsteadreplacementretributionsubstituteconsequencesconsequencewagesapodosisnemesisquittancerecompenserepaymenteternalgratuityearningemployermeedwageconsoundconsiderationgratificationindemnityreparationrecompensingearningsquidproquoquid pro quotruckagechargeablecompensatedindemnificationremuneratedremunerativebonkingchargeablycollyingreimbursedreimbursescompensatorycompenseestuanceperpensityreamputationrecommitmentrecompensationreimburserreimbursingremunerableremuneratingremuneratoryinterconvertdailypittancedaily wagesstipenddwellinghomeabnormalhaltlocationnicheoccasionpositionrankstationstatusfeeremunerationrenttariffleasingsleasowingtenuecongeneracyindevotionindivinityindivisionrewardsawmsawahecho evaporategageimportunejibleapobstructwaftflypersistblow flyfleawortfling offflyblownfleyingfliersflingingfliskingflockingflypeflypingflyteflytingflywheelsdriftpiecedriftwindfleenfleetenfly catchingfarefeloniousmalignancypiquegallrancourspitejobjob worklaboringlaborismlabourismvicemulctforfeitpenaltyspiny finnedcullyingfinedfinessedfinnedsubstitutionversionappositionequivalent calldemandhungerinquiryneedfulnessquestrequestsalarysearchseekingsolicitationwishyenaskancesoughtsought afterrequiemsrequitrequotessummonablesummonsesallowancepaycheckanteatonementpenancepropiationangulationatonalityexpectorationexpiationexpiativeexponentiationatonementsexpiatorexpunctaffronterbarterinterconversiondamagedemurragefine impositionconsecrationdevotionransomredemptionsacrificelosspunishmentengagepledgepledgeevowercoventimpledgevowessalledgecledgecledgypledgerytransferexchangeabilityexchangedinterchangeabilityinterchangeablenessswapswopexchangingswapperswappersswappingsswapsswaptionswoppedswoppingswopsinterchangementinterchangingoverchangepartakeparticipateparticipleparticipializeparticipializingretortreprisalvengefulnessreprisalsrevisalsvengeancesvengesresiegeretrimentvengement
Idioms related to the meaning of Badlaa - بدلہ
To forget a wrong is the best revenge | برائی کو بھلا دینا ہی بہترین انتقام ہے |
Value in exchange | تبدیلی کی قیمت |
What are the meanings of Badlaa - بدلہ in English?
Meanings of the word Badlaa - بدلہ in English are compensation, lieu, vengeance, wage, wages, exchange, interchange, payment, replacement, requital, retaliation, retort, retribution, revenge, avengement, avenges, avenses, retributed, retributes, revenges, avenage, recompensement, revengement and in exchange for. To understand how would you translate the word Badlaa - بدلہ in English, you can take help from words closely related to Badlaa - بدلہ or it’s English translations. Some of these words can also be considered Badlaa - بدلہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Badlaa - بدلہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Badlaa - بدلہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Badlaa - بدلہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Badlaa - بدلہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by badlaa?
Meanings of badlaa are compensation, lieu, vengeance, wage, wages, exchange, interchange, payment, replacement, requital, retaliation, retort, retribution, revenge, avengement, avenges, avenses, retributed, retributes, revenges, avenage, recompensement, revengement and in exchange for
Whats the definition of badlaa?
Definition of the badlaa are
- something (such as money) given or received as payment or reparation (as for a service or loss or injury)
- (psychiatry) a defense mechanism that conceals your undesirable shortcomings by exaggerating desirable behaviors
- the act of compensating for service or loss or injury
- the post or function properly or customarily occupied or served by another
- the act of taking revenge (harming someone in retaliation for something harmful that they have done) especially in the next life
- something that remunerates
- carry on (wars, battles, or campaigns)
- a recompense for worthy acts or retribution for wrongdoing
- a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication
- exchange or replace with another, usually of the same kind or category
- give to, and receive from, one another
- exchange a penalty for a less severe one
- (sports) an unbroken sequence of several successive strokes
- (chess) the capture by both players (usually on consecutive moves) of pieces of equal value
- (chess) gaining (or losing) a rook in return for a knight or bishop
- reciprocal transfer of equivalent sums of money (especially the currencies of different countries)
- the act of giving something in return for something received
- the act of changing one thing for another thing
- a mutual expression of views (especially an unpleasant one)
- chemical process in which one atom or ion or group changes places with another
- the act of putting one thing or person in the place of another:
- a workplace for buying and selling; open only to members
- change over, change around, as to a new order or sequence
- put in the place of another; switch seemingly equivalent items
- hand over one and receive another, approximately equivalent
- give to, and receive from, one another
- cause to change places
- reciprocal transfer of equivalent sums of money (especially the currencies of different countries)
- the act of changing one thing for another thing
- a junction of highways on different levels that permits traffic to move from one to another without crossing traffic streams
- put in the place of another; switch seemingly equivalent items
- mutual interaction; the activity of reciprocating or exchanging (especially information)
- the act of paying money
- a sum of money paid or a claim discharged
- an act of requiting; returning in kind
- a person who follows next in order
- someone who takes the place of another person
- an event in which one thing is substituted for another
- the act of furnishing an equivalent person or thing in the place of another
- a person or thing that takes or can take the place of another
- filling again by supplying what has been used up
- a justly deserved penalty
- an act of requiting; returning in kind
- action taken in return for an injury or offense
- a quick reply to a question or remark (especially a witty or critical one)
- answer back
- a vessel where substances are distilled or decomposed by heat
- the act of taking revenge (harming someone in retaliation for something harmful that they have done) especially in the next life
- the act of correcting for your wrongdoing
- a justly deserved penalty
- take revenge for a perceived wrong
- action taken in return for an injury or offense
What is the synonym of badlaa?
Synonym of word badlaa are بدلہ, پلٹا, عوض, جزا, اجر, مکافات, تلافی, تَلافی کا عمَل, بَدلا, اَجَر
What are the idioms related to badlaa?
Here are the idioms that are related to the word badlaa.
- In lieu of
- A good servant should have good wages
- Blame is the lazy man's wages
- Living wage
- Make wage war