Baraabar - برابر meanings in English
Baraabar - برابر meanings in English are abreast, opposite, quits, straight, uniform, up to, equably, equalised, equalisers, equalized, equalizers, equalizes, equalled, equalling, equals, levered, next, level, identical, ceaseless, continuous, coequal, equable, equal, equally, flat, like, tantamount, adjoining, alike, constantly, continually, equivalent, even, epanthous Baraabar - برابر in English. More meanings of baraabar - برابر, it's definitions, example sentences, related words, idioms and quotations.
abreast opposite quits straight uniform up to equably equalised equalisers equalized equalizers equalizes equalled equalling equals levered next level identical ceaseless continuous coequal equable equal equally flat like tantamount adjoining alike constantly continually equivalent even epanthous
Baraabar - برابر Definitions
Please find 124 English and 1 Urdu definitions related to the word Baraabar - برابر.
- (adjective satellite) : being up to particular standard or level especially in being up to date in knowledge
- (adverb) : alongside each other, facing in the same direction
- (adjective satellite) : uninterrupted in time and indefinitely long continuing
- (adjective) : continuing in time or space without interruption
- (adjective) : of a function or curve; extending without break or irregularity
- (adverb) : without interruption
- (adverb) : without variation or change, in every case
- (adjective satellite) : having the same standing before the law
- (noun) : the atomic weight of an element that has the same combining capacity as a given weight of another element; the standard is 8 for oxygen
- (noun) : a person or thing equal to another in value or measure or force or effect or significance etc
- (adjective satellite) : being essentially equal to something
- (verb) : make equal, uniform, corresponding, or matching
- (noun) : a person who is of equal standing with another in a group
- (verb) : be identical or equivalent to
- (verb) : be equal to in quality or ability
- (adjective) : having the requisite qualities or resources to meet a task
- (adjective) : having the same quantity, value, or measure as another
- (adverb) : in equal amounts or shares; in a balanced or impartial way
- (adverb) : to the same degree (often followed by as')
- (noun) : the latter part of the day (the period of decreasing daylight from late afternoon until nightfall)
- (verb) : make even or more even
- (verb) : become even or more even
- (adjective satellite) : occurring at fixed intervals
- (adjective satellite) : symmetrically arranged
- (adjective satellite) : equal in degree or extent or amount; or equally matched or balanced
- (adjective) : being level or straight or regular and without variation as e.g. in shape or texture; or being in the same plane or at the same height as something else (i.e. even with)
- (adjective) : divisible by two
- (adjective satellite) : of the score in a contest
- (adverb) : used as an intensive especially to indicate something unexpected
- (adverb) : to a greater degree or extent; used with comparisons
- (adverb) : in spite of; notwithstanding
- (adverb) : to the full extent
- (adjective satellite) : lacking stimulating characteristics; uninteresting
- (adjective satellite) : lacking taste or flavor or tang
- (adjective satellite) : flattened laterally along the whole length (e.g., certain leafstalks or flatfishes)
- (noun) : scenery consisting of a wooden frame covered with painted canvas; part of a stage setting
- (noun) : a deflated pneumatic tire
- (noun) : a shallow box in which seedlings are started
- (noun) : a musical notation indicating one half step lower than the note named
- (noun) : a level tract of land
- (noun) : a suite of rooms usually on one floor of an apartment house
- (noun) : freight car without permanent sides or roof
- (adjective satellite) : having lost effervescence
- (adjective satellite) : not reflecting light; not glossy
- (adjective) : lacking contrast or shading between tones
- (adjective satellite) : lacking the expected range or depth; not designed to give an illusion or depth
- (adjective satellite) : not modified or restricted by reservations
- (adverb) : with flat sails
- (adverb) : in a forthright manner; candidly or frankly
- (adjective satellite) : sounded or spoken in a tone unvarying in pitch
- (adjective satellite) : commercially inactive
- (adjective satellite) : having a relatively broad surface in relation to depth or thickness
- (adjective satellite) : horizontally level
- (adjective) : (of a musical note) lowered in pitch by one chromatic semitone
- (adjective satellite) : having a surface without slope, tilt in which no part is higher or lower than another
- (adjective satellite) : having properties with uniform values along all axes
- (adjective satellite) : exactly alike; incapable of being perceived as different
- (adjective satellite) : being the exact same one; not any other:
- (adjective) : (of twins) derived from a single egg or ovum
- (adjective satellite) : coinciding exactly when superimposed
- (adjective satellite) : of the score in a contest
- (noun) : a structure consisting of a room or set of rooms at a single position along a vertical scale
- (adjective satellite) : having a surface without slope, tilt in which no part is higher or lower than another
- (verb) : prefer or wish to do something
- (adjective satellite) : conforming in every respect
- (noun) : a kind of person
- (verb) : feel about or towards; consider, evaluate, or regard
- (verb) : be fond of
- (verb) : find enjoyable or agreeable
- (verb) : want to have
- (adjective) : resembling or similar; having the same or some of the same characteristics; often used in combination
- (adjective) : having the same or similar characteristics
- (noun) : a similar kind
- (adjective satellite) : immediately following in time or order
- (adjective satellite) : (of elected officers) elected but not yet serving
- (adjective satellite) : nearest in space or position; immediately adjoining without intervening space
- (adverb) : at the time or occasion immediately following
- (adjective satellite) : (of a day of the week) nearest (or nearest but one) after the present moment
- (noun) : a relation of direct opposition
- (noun) : something inverted in sequence or character or effect
- (adjective) : of leaves etc; growing in pairs on either side of a stem
- (adjective satellite) : altogether different in nature or quality or significance
- (adjective satellite) : the other one of a complementary pair
- (adjective satellite) : being directly across from each other; facing
- (adjective satellite) : moving or facing away from each other
- (adjective satellite) : characterized by opposite extremes; completely opposed
- (adverb) : directly facing each other
- (noun) : a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- (adjective satellite) : successive (without a break)
- (adverb) : without deviation
- (adverb) : in a forthright manner; candidly or frankly
- (noun) : a poker hand with 5 consecutive cards (regardless of suit)
- (noun) : a straight segment of a roadway or racecourse
- (adjective satellite) : not homosexual
- (adjective satellite) : erect in posture
- (adjective) : having no deviations
- (adjective satellite) : neatly arranged; not disorderly
- (adjective satellite) : following a correct or logical method
- (adjective) : (of hair) having no waves or curls
- (adjective) : characterized by honesty and fairness
- (adjective) : no longer coiled
- (adjective satellite) : rigidly conventional or old-fashioned
- (adjective satellite) : accurately fitted; level
- (adverb) : in a straight line; in a direct course
- (adjective satellite) : without evasion or compromise
- (adjective satellite) : in keeping with the facts
- (adjective) : free from curves or angles
- (adjective satellite) : (of an alcoholic drink) without water
- (noun) : a person having a sexual orientation to persons of the opposite sex
- (adjective satellite) : being essentially equal to something
- (adjective) : having the same or similar characteristics
- (adverb) : equally
- (adverb) : in a like manner
- (adverb) : seemingly without interruption
- (adverb) : in an equable manner
- (adjective satellite) : on equal terms by payment or requital
- (adjective satellite) : the same throughout in structure or composition
- (noun) : clothing of distinctive design worn by members of a particular group as a means of identification
- (verb) : provide with uniforms
- (adjective) : not differentiated
- (adjective satellite) : evenly spaced
- (adjective) : always the same; showing a single form or character in all occurrences
- (adjective satellite) : having the requisite qualities for
- (adjective satellite) : busy or occupied with
- وہ خط جس کا ہر ایک نقطہ مرکز زمین سے برابر دوری پر ہو
More words related to the meanings of Baraabar - برابر
More words from English related to Baraabar - برابر
View an extensive list of words below that are related to the meanings of the word Baraabar - برابر meanings in English in English.
above boardbroadlyclearopenlyovertlydistinct downrightstraightabreastcollateralconcurrentlycoincidentallyalongalongshoretete a teteabsolutelydiametricallyentirelyevenfullquiteaccuracycompletelyexactfullyout and outpositivelythroughoututterlyverywhollyat allrightmostutternessallenarlyethereallyelocutivequitlyaccedeacceptacquiesceembracehomologatelikeacknowledgeallowconcedeconcurconsentgrant ... nodratifyrecognisesanctionundertakeaccommodateflattenlevelunifoliateuniformizeunifollilateaffluentagoingbastardycontinuouscontinueeffluentlewdnessprofligacycontinuingcurrentflowingprevalentriferunningunstoppableissuableissuancesreleasableunleashedunleashingafterwardsagainthenalthoughandbutmorenotwithstandingsothenalthenarthenaboutsthenarsthensaffiliatedadjoiningannexmentsagainstversuscontradictorycontraryin opposition tooppositeagainstandcontrarietyfrowardnessobduracyobduratenessopinionativenesswaywardnessantilogyantithesiscontrarinessdournesseffronteryenmityinflexibilityinverseobstinacyoppositionpersistencepertinacityantitheticantitumorantitussivestub outstubbinessanticousantistaticantitheiststubbierstubbieststubblesstubblierstubblieststubbornedstubbornsanticontagiousantitropousstibbornstubbednessagreeableagreeablyappositecorrespondentconsonantfavourable friendshipkindredmatchablepursuantsuitableaccommodatingadvisabilecompatiblemodularwelladaptativecommensurateconformablyconformistconsentientcoincidesconcinnityconcinnousconformedaphorismdictumlikenessquasiwakeanalogouscopyexampleproverbrecordresemblingsimilarapplicablepataccordingattunedbefittingconformablein accordance withanalogisedanalogizedconformscapablemonkhoodtantamountwarrantableyogaapprovecountenanceselectchoosefancylikersapproximatenearnextapproximativeimmediaeimminentnighstrictadjacentakinalmostapproachingapproximatelycontiguousat handto handhandyimmediateclosemouthedclosernearernearsideproximalafearingclosersnearednearingnearsnighnessupclosevicingapproacherapproximatedapproximatingclose barrednearcticnearhandneatifyproximebyneighbouringcloseensnaresensnaringensnarlingarticulatacandidcleanlydiaphanous empyrealfoolproofglaringglossyguilelessimpartiallightlimpidneatshinysinceresmugtaint freetaintlesstidywhistlecleanclearlydirect distinctly explicitexpresslyfairingenuouslegiblelucidplainplainlypurestraightforwarduncontaminatedbrushedcleanableclearedneatenunbrushedbrushlesscleanedcleanscleansedcleansescleatedneapedneatenedneaterpurfledpurgedpurledrefiguredrepinedsanifiedsweepytiddyunswatheswipedperfectfranklylegiblymanifestlynakedlyplumpbarelyexplicitlyoutrightunambiguousunambiguouslyunequivocalunequivocallycatenarianarrangedclassifiedconsecutiveunbrokenseriallychainworkchainworkscontinuative concurrenteternalserialchainedcoherentcontinuedhourlysuccessiveunceasingunendingunremittingstretchinessstretchycontinuasolutiveincessantcategoryclassgradeparticleranksegmenttiercompartmentdegreemarksstationranknessceaselesssuccessivelyconstantansuccessivenessinfallibleunmistakeableconsecutivelycontinuumthwartwisethwartwayssequentiallyeternallyalwaysinvariablycriterionidealmodularityqualityaccuratecalibregaugemodulusnormnormalparstandardyardstickbenchmarkcriterionalcriteriaclutchesfaculty forcelustinessmightmightinesspepvaliantvimabilitycapabilityenergygutinputmainpowerstrengthvaliantnessvigourvisentirenesspotencepoweredpowerfulnessshaktistrenuositypotentisepoweringpowteredboweriesentiertypotancepotentacypotentnessstreightstrengthyvilitymixedcomposedjoinedvicinalcommonalikeidenticalone to onesamecommonlycustomarilygenerallymanymostmostlycontinuallyfrequentfrequentlymuchoftoftenoftentimesusuallyoftenerfrequentsoftenestoftentidecompactfastadherentconglomeratelinkedoldpermanentstickingconclusiveclear cutdecisiveexpresscategoricalbluntingbluntishblunt witteduninterruptedperiodicperiodicalobsequentperiodicalistcontraconversely oppositelyabout faceantipodalcontrasto the contrarycontraindicateddissimilar enemy hostileobjectoropponentoppugnantvariousadversaryadverseanticonfrontationaldissenterinimicalopposedvillainadversativeantagonistantagonisticanticanceropposableopposeradverserantlikeopposelessoppositesadversariousantagonisticalantagonizedanticorobversantoppositionistoppositipetalouskinresemblerresemblersflat homogeneouscouplepairspouseteamyokeequalmatchduetduoscompetitoremulousjeererrivalviercontestantnemesisrivalrouspredialrivalessrivalisedrivalizedrivalledrivallessrivuletsbivalvousrivosecomparablerhythmicconsistentharmoniousuniformco ordinatedcoexistentconcordantcoheredconjugantsyndedaccompanablecorrespondingcounterpartosculantmatchedlibkenlikenedsemblativesimilativeemmarbleimborderedmammalogicalconstantlyever ayeforeverincessantlyperpetuallysempreeternisealwaycoordinationcommittedadheringboundfetterfettered following limitedsubjugatedsubordinatebindablebindweedbondablebound upboundenbongedboundingconducegravitatemindtendleanvergeinclinnationto be inclinedcoequalequablemonotonicdrabequallyidenticmatchingalkyhomoeciousunifacialuniformiseuniformnessuniparousconsimilarenscheduleunisonalunisonantuniformaluniformitarianuniphonousconnotativediametricerectfacilejustnaiveartlessdextergentlemanageablemansueteorthosimpleuprightstraightarrowstraightenerstraightedshrightditto what alldriveller dupefoolgreenhorngullibleshallow brainedsimpletoncoxcombgagagandergawkgoofylambverdantzanylikewisesimilarlysamelysamenspokewisesuchwisethatawaythuswisedissimilarlytalewisealsotooalsoontoolersfeloniousfoefiendfoemanfoemenfoeseneidensuinghypercontiguousnessincumbent onpostpositivestipulatorytendentiousnesseffigurateinduinginherencesobumbratesoutsummingoutswimoutswimsoutvaluedoverlaidreplevinedstipularysundermentboroughmongerboroughmongerycompaniablecompatientcompendiariousenchainmentfissilingualintangibilitiesinterjectionarysupersubstantialsmoothoperatorsmoothvelvetyplanepavedpavingseamysmooth outsmooth oversmooth facedsmooth shavensmooth spokensmoothbarksmoothboresmoothedsmoothenedsmoothersmoothhoundsmoothiesmoothystreamlinedpavementedpavesseamiestsmootedsmoothesmoothenssmoothessmoothiessmoothingsmoothingssmoothishsmoothpatesmoothsequalize likenmoderateequateequaliseequalisingequalizingcouchiron outtrimlevel offequitablypreciselyunbiasedvalidlyfine grainedsubtlersubtlestpost fineequivalent synonymousparallelequanimousequidequusequantequatedequatesequidsequiseticequitantequaledequalingequangularequi equiangledequicrescentequicruralequidifferentequidiurnalequiformequilibratedequilibriousequimomentalequinalequinumerantequiparableequiponderantequiponderousequiradicalequirotalequisetaceousequisonantequitemporaneousequivalvedequivocatedequivorousplusconverseplausiveobvolutedversalcompunctiousheremiticaloblocutorisopedwhateveras many asdrudgelabouretcaeteraunfailingnewlyrecentlynow nowrectangularblankdesolatedestroyedfallenmessobtuseplanarcompressedflattenedlevelledflatten outflatlongflattensspicyfloor abodedestinationgoalgreejourneyday's journeylandingmansionobjectivestoreytrekforemostformerfurtherfutureaheadfartherfirstforthcomingneighbourpredecessorpreviousotheranothersecond2ndsecondarilysecondersecondingt'otherforthcomingnessrectoralforwardyonderafrontbeforefacing in frontfrontallyout frontfrontagesfaciendceaselesslyin successionthicklyunremittinglyulteriorgenuinehonourabletruthfulcorrecthonesttrueunerringvirgategermaneoccupiedday and nightsaamenearbynon segregatedadjunctiveconniventimplorelustmanducatemasticateneedproposewishcherishdesirehankeroughtwantyearnyenjakelickassaultattackblowchargeonfallonslaughtstrokestabslike thissuchthis kindthusjust aslookalikescitationcomparisonisotopeprecedentpremonitoryvotarymashmatefriendpeerplaymatearoundneighbourhoodsurroundingmuck aroundpass aroundwaltz aroundvicaragesvicaressesvicariatesvicinagesvicinitiesobverselyawrybackcrookedinverselyleftreversewronginvertasereverselyreversiblyupsideupside downinversedinversinginversionsinversiveinvertedlyrenverserenversedsubversedsubvertedprosecutoraccuserclaimantcomplainantlitigantplaintiffplainchantplaintiveplaintiffsplainantface to facevis a visoppositiveoverturninexactretrogradereversalreversionreversreversedreversiveultinversesobversesoverturnsreversalsreversedlyreversesreversingreversingsreversisreverselessskewerspitchapattianswerobverseparagonrefusalrejectionrejoinderreplyresponserespondencerespondencynamelysubstitutionversionappositionchangeersatzexchangesynonymequivocallysynonymistsynonymitysynonymouslyequivoqueequivoquestenabletenaciousfirmindissolubleinviolatepowerfulsolidstrengthenedstrongshoulder to shoulderside by sideside to sideclashconflictconflictingcontradictiondiscordantinconsequentcountercomingin futurehereaftersubsequentlyas far astillup toblanduneventfuluninspiredvacantboredbroken offdejecteddisenchanteddisgusteddishearteneddissatisfieddowncastdullhumdrumoffendedprosaicrestlesssadseparatedsorrowfulweariedworn outclosely togetherindefatigibleconsequentialsubsequentevery dayrepeatedlyunceasinglydeadfecklessinanimateinsensateinsentientlifelesssoullessvapidvegetativefatlesslifelesslylifelessnessnon livingnonlivingunintoxicatedunfeaturedunvizardedunwarnedearnestfulidlessinaniloquentrescuelessunanimateunfeatyinsofaruntilgod almightyabove namedliverydress uniformunifilarverdiunciformunifieruniformingveridicousmethodicalorderlysystematictrigclose grainednighestneatestquitsuntountooth
Idioms related to the meaning of Baraabar - برابر
What are the meanings of Baraabar - برابر in English?
Meanings of the word Baraabar - برابر in English are abreast, ceaseless, continuous, constantly, coequal, equable, equivalent, equal, equally, even, flat, identical, level, like, next, opposite, straight, tantamount, alike, continually, equably, quits, uniform, up to, adjoining, equalised, equalisers, equalized, equalizers, equalizes, equalled, equalling, equals, levered and epanthous. To understand how would you translate the word Baraabar - برابر in English, you can take help from words closely related to Baraabar - برابر or it’s English translations. Some of these words can also be considered Baraabar - برابر synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Baraabar - برابر. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Baraabar - برابر in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Baraabar - برابر in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Baraabar - برابر with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by baraabar?
Meanings of baraabar are abreast, ceaseless, continuous, constantly, coequal, equable, equivalent, equal, equally, even, flat, identical, level, like, next, opposite, straight, tantamount, alike, continually, equably, quits, uniform, up to, adjoining, equalised, equalisers, equalized, equalizers, equalizes, equalled, equalling, equals, levered and epanthous
Whats the definition of baraabar?
Definition of the baraabar are
- being up to particular standard or level especially in being up to date in knowledge
- alongside each other, facing in the same direction
- uninterrupted in time and indefinitely long continuing
- continuing in time or space without interruption
- of a function or curve; extending without break or irregularity
- without interruption
- without variation or change, in every case
- having the same standing before the law
- the atomic weight of an element that has the same combining capacity as a given weight of another element; the standard is 8 for oxygen
- a person or thing equal to another in value or measure or force or effect or significance etc
- being essentially equal to something
- make equal, uniform, corresponding, or matching
- a person who is of equal standing with another in a group
- be identical or equivalent to
- be equal to in quality or ability
- having the requisite qualities or resources to meet a task
- having the same quantity, value, or measure as another
- in equal amounts or shares; in a balanced or impartial way
- to the same degree (often followed by as')
- the latter part of the day (the period of decreasing daylight from late afternoon until nightfall)
- make even or more even
- become even or more even
- occurring at fixed intervals
- symmetrically arranged
- equal in degree or extent or amount; or equally matched or balanced
- being level or straight or regular and without variation as e.g. in shape or texture; or being in the same plane or at the same height as something else (i.e. even with)
- divisible by two
- of the score in a contest
- used as an intensive especially to indicate something unexpected
- to a greater degree or extent; used with comparisons
- in spite of; notwithstanding
- to the full extent
- lacking stimulating characteristics; uninteresting
- lacking taste or flavor or tang
- flattened laterally along the whole length (e.g., certain leafstalks or flatfishes)
- scenery consisting of a wooden frame covered with painted canvas; part of a stage setting
- a deflated pneumatic tire
- a shallow box in which seedlings are started
- a musical notation indicating one half step lower than the note named
- a level tract of land
- a suite of rooms usually on one floor of an apartment house
- freight car without permanent sides or roof
- having lost effervescence
- not reflecting light; not glossy
- lacking contrast or shading between tones
- lacking the expected range or depth; not designed to give an illusion or depth
- not modified or restricted by reservations
- with flat sails
- in a forthright manner; candidly or frankly
- sounded or spoken in a tone unvarying in pitch
- commercially inactive
- having a relatively broad surface in relation to depth or thickness
- horizontally level
- (of a musical note) lowered in pitch by one chromatic semitone
- having a surface without slope, tilt in which no part is higher or lower than another
- having properties with uniform values along all axes
- exactly alike; incapable of being perceived as different
- being the exact same one; not any other:
- (of twins) derived from a single egg or ovum
- coinciding exactly when superimposed
- of the score in a contest
- a structure consisting of a room or set of rooms at a single position along a vertical scale
- having a surface without slope, tilt in which no part is higher or lower than another
- prefer or wish to do something
- conforming in every respect
- a kind of person
- feel about or towards; consider, evaluate, or regard
- be fond of
- find enjoyable or agreeable
- want to have
- resembling or similar; having the same or some of the same characteristics; often used in combination
- having the same or similar characteristics
- a similar kind
- immediately following in time or order
- (of elected officers) elected but not yet serving
- nearest in space or position; immediately adjoining without intervening space
- at the time or occasion immediately following
- (of a day of the week) nearest (or nearest but one) after the present moment
- a relation of direct opposition
- something inverted in sequence or character or effect
- of leaves etc; growing in pairs on either side of a stem
- altogether different in nature or quality or significance
- the other one of a complementary pair
- being directly across from each other; facing
- moving or facing away from each other
- characterized by opposite extremes; completely opposed
- directly facing each other
- a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- successive (without a break)
- without deviation
- in a forthright manner; candidly or frankly
- a poker hand with 5 consecutive cards (regardless of suit)
- a straight segment of a roadway or racecourse
- not homosexual
- erect in posture
- having no deviations
- neatly arranged; not disorderly
- following a correct or logical method
- (of hair) having no waves or curls
- characterized by honesty and fairness
- no longer coiled
- rigidly conventional or old-fashioned
- accurately fitted; level
- in a straight line; in a direct course
- without evasion or compromise
- in keeping with the facts
- free from curves or angles
- (of an alcoholic drink) without water
- a person having a sexual orientation to persons of the opposite sex
- being essentially equal to something
- having the same or similar characteristics
- equally
- in a like manner
- seemingly without interruption
- in an equable manner
- on equal terms by payment or requital
- the same throughout in structure or composition
- clothing of distinctive design worn by members of a particular group as a means of identification
- provide with uniforms
- not differentiated
- evenly spaced
- always the same; showing a single form or character in all occurrences
- having the requisite qualities for
- busy or occupied with
- وہ خط جس کا ہر ایک نقطہ مرکز زمین سے برابر دوری پر ہو
What is the synonym of baraabar?
Synonym of word baraabar are پہلو بہ پہلو, ہم قدم, ساتھ ساتھ, برابر, صف بستہ, دوش بدوش, شانہ بہ شانہ, لگاتار, اچھوٹ, بے چوک
What are the idioms related to baraabar?
Here are the idioms that are related to the word baraabar.
- From all sides there is equally a way to the lower world
- It's poor friendship that needs to be constantly bought
- Jest with your equals
- Justice is a firm and continuous desire to render to every one that which is his due
- Taxes and gruel will continually grow thicker