Bhaagna - بھاگنا meanings in English
Bhaagna - بھاگنا meanings in English are drive, race, run, flee, run away, break away, breakaway, spear up, fleigh Bhaagna - بھاگنا in English. More meanings of bhaagna - بھاگنا, it's definitions, example sentences, related words, idioms and quotations.
drive race run flee run away break away breakaway spear up fleigh
Bhaagna - بھاگنا Definitions
Please find 108 English and 1 Urdu definitions related to the word Bhaagna - بھاگنا.
- (noun) : a series of actions advancing a principle or tending toward a particular end
- (verb) : have certain properties when driven
- (verb) : travel or be transported in a vehicle
- (verb) : proceed along in a vehicle
- (verb) : strive and make an effort to reach a goal
- (verb) : cause to move back by force or influence
- (noun) : the act of applying force to propel something
- (noun) : a journey in a vehicle (usually an automobile)
- (noun) : the act of driving a herd of animals overland
- (noun) : (sports) a hard straight return (as in tennis or squash)
- (noun) : hitting a golf ball off of a tee with a driver
- (noun) : a wide scenic road planted with trees
- (noun) : a mechanism by which force or power is transmitted in a machine
- (noun) : (computer science) a device that writes data onto or reads data from a storage medium
- (noun) : a road leading up to a private house
- (noun) : the trait of being highly motivated
- (noun) : a physiological state corresponding to a strong need or desire
- (verb) : cause to function by supplying the force or power for or by controlling
- (verb) : excavate horizontally
- (verb) : cause to move rapidly by striking or throwing with force
- (verb) : operate or control a vehicle
- (verb) : urge forward
- (verb) : cause someone or something to move by driving
- (verb) : move by being propelled by a force
- (verb) : work as a driver
- (verb) : (hunting) chase from cover into more open ground
- (verb) : (hunting) search for game
- (verb) : hit very hard, as by swinging a bat horizontally
- (verb) : strike with a driver, as in teeing off
- (verb) : push, propel, or press with force
- (verb) : compel somebody to do something, often against his own will or judgment
- (verb) : to compel or force or urge relentlessly or exert coercive pressure on, or motivate strongly
- (verb) : run away quickly
- (noun) : a contest of speed
- (noun) : any competition
- (noun) : people who are believed to belong to the same genetic stock
- (noun) : a canal for a current of water
- (noun) : (biology) a taxonomic group that is a division of a species; usually arises as a consequence of geographical isolation within a species
- (noun) : the flow of air that is driven backwards by an aircraft propeller
- (verb) : cause to move fast or to rush or race
- (verb) : to work as fast as possible towards a goal, sometimes in competition with others
- (verb) : compete in a race
- (verb) : move hurridly
- (verb) : be diffused
- (verb) : flee; take to one's heels; cut and run
- (verb) : include as the content; broadcast or publicize
- (noun) : a race between candidates for elective office
- (verb) : run, stand, or compete for an office or a position
- (verb) : keep company
- (verb) : move along, of liquids
- (verb) : continue to exist
- (verb) : perform as expected when applied
- (verb) : pursue for food or sport (as of wild animals)
- (verb) : cause something to pass or lead somewhere
- (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (verb) : have a tendency or disposition to do or be something; be inclined
- (verb) : progress by being changed
- (verb) : direct or control; projects, businesses, etc.
- (verb) : compete in a race
- (noun) : a row of unravelled stitches
- (verb) : change or be different within limits
- (noun) : a small stream
- (noun) : a score in baseball made by a runner touching all four bases safely
- (noun) : the act of running; traveling on foot at a fast pace
- (noun) : a regular trip
- (noun) : a short trip
- (noun) : an unbroken chronological sequence
- (noun) : the production achieved during a continuous period of operation (of a machine or factory etc.)
- (noun) : unrestricted freedom to use
- (noun) : the continuous period of time during which something (a machine or a factory) operates or continues in operation
- (noun) : an unbroken series of events
- (noun) : the act of testing something
- (noun) : a race run on foot
- (verb) : cause an animal to move fast
- (verb) : move about freely and without restraint, or act as if running around in an uncontrolled way
- (verb) : deal in illegally, such as arms or liquor
- (verb) : set animals loose to graze
- (verb) : make without a miss
- (verb) : carry out a process or program, as on a computer or a machine
- (verb) : occur persistently
- (verb) : extend or continue for a certain period of time
- (verb) : be affected by; be subjected to
- (verb) : have a particular form
- (verb) : become undone
- (verb) : cause to perform
- (verb) : change from one state to another
- (verb) : be operating, running or functioning
- (verb) : carry out
- (verb) : cover by running; run a certain distance
- (verb) : move fast by using one's feet, with one foot off the ground at any given time
- (verb) : travel rapidly, by any (unspecified) means
- (verb) : run with the ball; in such sports as football
- (verb) : sail before the wind
- (verb) : come unraveled or undone as if by snagging
- (verb) : reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (noun) : (American football) a play in which a player attempts to carry the ball through or past the opposing team
- (verb) : cause to emit recorded audio or video
- (verb) : pass over, across, or through
- (verb) : move away or escape suddenly
- (verb) : interrupt a continued activity
- (verb) : flee; take to one's heels; cut and run
- (verb) : break off (a piece from a whole)
- (verb) : withdraw from an organization or communion
- (adjective satellite) : having separated or advocating separation from another entity or policy or attitude
- (noun) : the act of breaking away or withdrawing from
- (verb) : flee; take to one's heels; cut and run
- (verb) : escape from the control of
- (verb) : thrust up like a spear
- چلانا جیسے گاڑی میں بٹھا کر لے جانا
More words related to the meanings of Bhaagna - بھاگنا
More words from English related to Bhaagna - بھاگنا
View an extensive list of words below that are related to the meanings of the word Bhaagna - بھاگنا meanings in English in English.
abscondfleeescapelevantscamperskedaddledecampmizzlerun awayvamoserun offrush awayelopingfleaghaggrandizedilatedrive educateekeenhance escalatefurthermagnifymultiplyprolongaggrandiseamplifyenlargeexpandextendgrowincreaseliftpreferprotractstep upstretchenhancingestivatingentendagitateblewhollohoopimpelmanagemarchmoverantsnivel ... wagwalkbellowinitiateoperaterunstirweepyammerimplateemballaquajuicerainfallwatercharacterhonourlustreoriginracerainwatersdewaterbreedkindlineagestraindescentextractiongenealogygenerationpedigreeprogenyspawnstockethnicitygenus eaclesposteritybredbrededbreregennedgentesinbreedoutbreedareedbreededescendantcoursegallopscootcrushextract oilinsertpresspush backcravenfugitive runawayslackerabsconderrenegadetruantdisappearevaporateevanesceclear outvapourisedrift flowflushglidejetwaftdribblerunnyflowshurtlejogglejoltjustledashdinghustlejaculatejostleshove offfaregorepairtravelforgoingpervefleetchasedisperseenforcegiveholdjourneymakecomepaceproceedtreadlikewalkstokingtreadingstreadlingflitgrabattackbeatboundcatch a ballclawclutchdartflashhentlaunchmake hastepulsatesnapsnatchspringthroblippinghoundosseletboneboneletcordgrassherdessrushirruptionraceaboutslipslideabductdispelimbrueimbuemoilsaturatefolknationpeopletribegoadget offretreatfrownnationhoodnationalitynationalitiesnationalness
Idioms related to the meaning of Bhaagna - بھاگنا
What are the meanings of Bhaagna - بھاگنا in English?
Meanings of the word Bhaagna - بھاگنا in English are drive, flee, race, run, break away, breakaway, run away, spear up and fleigh. To understand how would you translate the word Bhaagna - بھاگنا in English, you can take help from words closely related to Bhaagna - بھاگنا or it’s English translations. Some of these words can also be considered Bhaagna - بھاگنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Bhaagna - بھاگنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Bhaagna - بھاگنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Bhaagna - بھاگنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Bhaagna - بھاگنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by bhaagna?
Meanings of bhaagna are drive, flee, race, run, break away, breakaway, run away, spear up and fleigh
Whats the definition of bhaagna?
Definition of the bhaagna are
- a series of actions advancing a principle or tending toward a particular end
- have certain properties when driven
- travel or be transported in a vehicle
- proceed along in a vehicle
- strive and make an effort to reach a goal
- cause to move back by force or influence
- the act of applying force to propel something
- a journey in a vehicle (usually an automobile)
- the act of driving a herd of animals overland
- (sports) a hard straight return (as in tennis or squash)
- hitting a golf ball off of a tee with a driver
- a wide scenic road planted with trees
- a mechanism by which force or power is transmitted in a machine
- (computer science) a device that writes data onto or reads data from a storage medium
- a road leading up to a private house
- the trait of being highly motivated
- a physiological state corresponding to a strong need or desire
- cause to function by supplying the force or power for or by controlling
- excavate horizontally
- cause to move rapidly by striking or throwing with force
- operate or control a vehicle
- urge forward
- cause someone or something to move by driving
- move by being propelled by a force
- work as a driver
- (hunting) chase from cover into more open ground
- (hunting) search for game
- hit very hard, as by swinging a bat horizontally
- strike with a driver, as in teeing off
- push, propel, or press with force
- compel somebody to do something, often against his own will or judgment
- to compel or force or urge relentlessly or exert coercive pressure on, or motivate strongly
- run away quickly
- a contest of speed
- any competition
- people who are believed to belong to the same genetic stock
- a canal for a current of water
- (biology) a taxonomic group that is a division of a species; usually arises as a consequence of geographical isolation within a species
- the flow of air that is driven backwards by an aircraft propeller
- cause to move fast or to rush or race
- to work as fast as possible towards a goal, sometimes in competition with others
- compete in a race
- move hurridly
- be diffused
- flee; take to one's heels; cut and run
- include as the content; broadcast or publicize
- a race between candidates for elective office
- run, stand, or compete for an office or a position
- keep company
- move along, of liquids
- continue to exist
- perform as expected when applied
- pursue for food or sport (as of wild animals)
- cause something to pass or lead somewhere
- stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- have a tendency or disposition to do or be something; be inclined
- progress by being changed
- direct or control; projects, businesses, etc.
- compete in a race
- a row of unravelled stitches
- change or be different within limits
- a small stream
- a score in baseball made by a runner touching all four bases safely
- the act of running; traveling on foot at a fast pace
- a regular trip
- a short trip
- an unbroken chronological sequence
- the production achieved during a continuous period of operation (of a machine or factory etc.)
- unrestricted freedom to use
- the continuous period of time during which something (a machine or a factory) operates or continues in operation
- an unbroken series of events
- the act of testing something
- a race run on foot
- cause an animal to move fast
- move about freely and without restraint, or act as if running around in an uncontrolled way
- deal in illegally, such as arms or liquor
- set animals loose to graze
- make without a miss
- carry out a process or program, as on a computer or a machine
- occur persistently
- extend or continue for a certain period of time
- be affected by; be subjected to
- have a particular form
- become undone
- cause to perform
- change from one state to another
- be operating, running or functioning
- carry out
- cover by running; run a certain distance
- move fast by using one's feet, with one foot off the ground at any given time
- travel rapidly, by any (unspecified) means
- run with the ball; in such sports as football
- sail before the wind
- come unraveled or undone as if by snagging
- reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (American football) a play in which a player attempts to carry the ball through or past the opposing team
- cause to emit recorded audio or video
- pass over, across, or through
- move away or escape suddenly
- interrupt a continued activity
- flee; take to one's heels; cut and run
- break off (a piece from a whole)
- withdraw from an organization or communion
- having separated or advocating separation from another entity or policy or attitude
- the act of breaking away or withdrawing from
- flee; take to one's heels; cut and run
- escape from the control of
- thrust up like a spear
- چلانا جیسے گاڑی میں بٹھا کر لے جانا
What is the synonym of bhaagna?
Synonym of word bhaagna are دھکا دینا, بڑھانا, آگے سرکانا, ہنکانا, چلانا, ریلنا, پیلنا, بھاگنا, ڈگرنا, جانا
What are the idioms related to bhaagna?
Here are the idioms that are related to the word bhaagna.
- Race hatred
- Slow and steady wins the race
- Slow and steady wins the race
- Slow and steady wins the race
- Do not flee conversation nor let your door be always shut