Bheyr - بھیڑ meanings in English

Bheyr - بھیڑ meanings in English are ewe, wold, conges, congests, crowdie, crowdies, overcrowds, sheepy, swarmings, swarms, throngs, tooled, wolds, heep, sheepish, overcrowd, huddle, rush, aggregation, caboodle, crowd, gathering, mass, mob, mong, multitude, sheep, swarm, crowding Bheyr - بھیڑ in English. More meanings of bheyr - بھیڑ, it's definitions, example sentences, related words, idioms and quotations.

ewe wold conges congests crowdie crowdies overcrowds sheepy swarmings swarms throngs tooled wolds heep sheepish overcrowd huddle rush aggregation caboodle crowd gathering mass mob mong multitude sheep swarm crowding sheep

Install chrome extension

Bheyr - بھیڑ Definitions

Please find 61 English and 1 Urdu definitions related to the word Bheyr - بھیڑ.

  • (noun) : an informal body of friends
  • (noun) : a large number of things or people considered together
  • (verb) : fill or occupy to the point of overflowing
  • (verb) : to gather together in large numbers
  • (verb) : approach a certain age or speed
  • (verb) : cause to herd, drive, or crowd together
  • (noun) : female sheep
  • (noun) : a member of a people living in southern Benin and Togo and southeastern Ghana
  • (noun) : a Kwa language spoken by the Ewe in Ghana and Togo and Benin
  • (noun) : the act of gathering something
  • (noun) : sewing consisting of small folds or puckers made by pulling tight a thread in a line of stitching
  • (noun) : a group of persons together in one place
  • (noun) : the social act of assembling
  • (noun) : a disorganized and densely packed crowd
  • (verb) : crouch or curl up
  • (verb) : crowd or draw together
  • (noun) : (informal) a quick private conference
  • (noun) : the property of something that is great in magnitude
  • (noun) : (Roman Catholic Church and Protestant Churches) the celebration of the Eucharist
  • (noun) : the property of a body that causes it to have weight in a gravitational field
  • (noun) : a sequence of prayers constituting the Christian eucharistic rite
  • (noun) : a musical setting for a Mass
  • (noun) : an ill-structured collection of similar things (objects or people)
  • (noun) : a body of matter without definite shape
  • (noun) : the common people generally
  • (verb) : join together into a mass or collect or form a mass
  • (adjective satellite) : formed of separate units gathered into a mass or whole
  • (noun) : (often followed by of') a large number or amount or extent
  • (noun) : the act of moving hurriedly and in a careless manner
  • (verb) : urge to an unnatural speed
  • (verb) : act or move at high speed
  • (verb) : cause to move fast or to rush or race
  • (noun) : (American football) an attempt to advance the ball by running into the line
  • (noun) : a sudden burst of activity
  • (noun) : a sudden forceful flow
  • (noun) : grasslike plants growing in wet places and having cylindrical often hollow stems
  • (verb) : run with the ball, in football
  • (verb) : attack suddenly
  • (verb) : cause to occur rapidly
  • (adjective satellite) : not accepting reservations
  • (adjective satellite) : done under pressure
  • (verb) : move hurridly
  • (noun) : physician and American Revolutionary leader; signer of the Declaration of Independence (1745-1813)
  • (noun) : woolly usually horned ruminant mammal related to the goat
  • (noun) : a docile and vulnerable person who would rather follow than make an independent decision
  • (noun) : a timid defenseless simpleton who is readily preyed upon
  • (verb) : move in large numbers
  • (verb) : be teeming, be abuzz
  • (noun) : a group of many things in the air or on the ground
  • (noun) : several things grouped together or considered as a whole
  • (noun) : the act of gathering something together
  • (noun) : any collection in its entirety
  • (noun) : a situation in which people or things are crowded together
  • (noun) : the common people generally
  • (noun) : a large indefinite number
  • (noun) : a large gathering of people
  • (verb) : crowd together too much
  • (verb) : cause to crowd together too much
  • (adjective satellite) : showing a sense of shame
  • (adjective satellite) : like or suggestive of a sheep in docility or stupidity or meekness or timidity
  • (noun) : a tract of open rolling country (especially upland)
  • شہد کی مکیھوں کا دل یا لشکر جو پہلا چھتہ چھوڑ کر اپنی ملکہ کے ساتھ نیا گھر بنانے کو نکل پڑا ہو

More words related to the meanings of Bheyr - بھیڑ

Crowdجتھا jatha جتھا Juttha مجمع majma مجمع Majmaa ہجُوم Hujoom اَزدحام جمِ غفیر بھِیڑ Bheed بھِیڑ Bheerd جَمگھَٹا Jamghatta بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird فوج fauj انبوہ anboh ہجوم hujuum ہجوم Hajoom گھمسان ghamsaan جلوت jalwat جلوت Jaloot جم گھٹا jam ghata بھیڑ جمع ہونا bhiir jama hona مجمع اکٹھا ہونا majma ikattha hona
Eweبھیڑی Bhairdi بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Gatheringمجلس Majlis مجلس Mujlis مجلس Majliss اجتماع ijtemaa مجمع majma مجمع Majmaa جماعت jamaaat جماعت Jama'at بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird ہجوم hujuum ہجوم Hajoom جھومر jhuumar محفل maehfil محفل Mahfil
Huddleہلچل hal chal ہلچل Halchal گٹھا بنانا gattha banaana افراتفری afra tafri افراتفری Afratafree گڑبڑ gar bar ابتری abtari بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird جلدی کرنا jaldi karna ہڑبڑی کرنا ہجوم یا بھیڑ کرنا انبوہ anboh گڑ بڑ gar bar گڈ مڈ ہونا gad mad hona خلت ملت کرنا khalat malat karna خلت ملت کرنا khalt malt karna
Massڈھیر dheyr ڈھیر Dhair تودہ Todah انبار anbaar ڈلا dala ڈلا Dalla تھوک thok تھوک thuuk تھوک Thook مقدار miqdaar مقدار meqdaar مقدار Miqdar بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird اژدہام azdahaam اژدہام az dahaam پشتارا pushtaara
Mobبھیڑ بھاڑ مجمع majma مجمع Majmaa عوام awaam بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird عوام الناس awaam un naas بلوہ balwah بلوہ Balooh انبوہ anboh ٹوٹ پڑنا tuut parna جم غفیر jamm e ghafiir ہجوم hujuum ہجوم Hajoom بازاری لوگ غلبہ کرنا ghalbah karna اژدہام azdahaam اژدہام az dahaam بلوا کرنا balwa karna جم گھٹ jam ghat ٹھٹھ thath
Rushجھوکا Jhoka بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird انبوہ anboh ٹھیلم ٹھیلا ہجوم hujuum ہجوم Hajoom جھپٹ jhapat دوڑ daur دوڑ Dorr ریلا Rela ہلہ hallah اژدہام azdahaam اژدہام az dahaam رش Rush جمگھٹا Lumghata مارا مار maara maar جالدی کرنا jaaldi karna مونجھ muunjh
Sheepبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird شرم sharm شرم Sharam بھیڑوں کے چرنےک کی جگہ
Swarmدل dil دل dal بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird ہجوم hujuum ہجوم Hajoom ہجوم کرنا غلا ghalla
Aggregationمجمع majma مجمع Majmaa بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Caboodleبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird غول ghol غول ghuul ذخیرہ zakhiirah ذخیرہ Zakheera ہجوم hujuum ہجوم Hajoom سارے کا سارا saarey ka saara
Crowdingبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Multitudeکثرت kasrat خلقت khilqat خلقت Khalqat خلقت Khalqut بھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird جماؤ jamaa o جماؤ Jamao فوج fauj انبوہ anboh جم غفیر jamm e ghafiir ہجوم hujuum ہجوم Hajoom
Overcrowdبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Sheepishبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Woldبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Congesبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Congestsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Crowdieبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Crowdiesبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Mongبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Overcrowdsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Sheepyبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Swarmingsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Swarmsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Throngsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Tooledبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Woldsبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird
Heepبھیڑ bhiir بھیڑ bheyr بھیڑ Bhaid بھیڑ Bhaird

More words from English related to Bheyr - بھیڑ

View an extensive list of words below that are related to the meanings of the word Bheyr - بھیڑ meanings in English in English.

abundanceflushfrequencyglutmuchmultiplicitynumerousnessopulenceoverstockpluralityprofusenessrampancyrichnessvastnessaffluencebulkexcessexuberanceinfestationinfluxlargenesslavishmuchnessmultitudenimietynumerosityoutpouringplentypleromaplethoraoftennesspolyvalenceaboundsabundancesabundancyfrequentagefrequentationmulierosityseveralityaccumulationagglomerationbankcongeriescongregationdrift massmucuspileabundantbing ...

Idioms related to the meaning of Bheyr - بھیڑ

The mob has many heads but no brainsخلقت میں سر بہت عقل تھوڑی
A mind moves the massارادہ مضبوط ہو تو انسان چٹانوں کو ہلا دیتا ہے
Gathering wealth is a pleasant painروپیہ کمانا خوشگوار تکلیف ہے
I do not hunt for the suffrages of the inconstant multitudeدانا آدمی عوام الناس کی تبدیلی پزیر راۓ کی پرواہ نہیں کرتے
Rolling stone gathers no massدھوبی کا کتا نہ گھر کا نہ گھاٹ کا
The views of the multitude are neither bad nor goodعوام الناس کی راۓ نہ اچھی نہ بُری
Your wits have gone a wool gatheringتمہاری عقل گھاس چرنے گئی ہے
Sheep and goats sheep eyeاچھا و برا پر امید نظر
Sheep and goats sheep eyeپر جوش نظر
A crowd is not companyمحبت اور شے ہے اور صحبت اور شے
A crowd of books distracts the mindزیادہ مطالعہ سے دماغ پریشان ہوتا ہے
He will pass in a crowdہزاروں میں ایک ہے لاکھوں میں یکتا
Ten constitute a crowdدس کا گروہ بن جاتا ہے
Who does not mix with the crowd knows nothingعام لوگوں سے ملے جلے بغیر کسی بات کا پتہ نہیں لگتا
A good man can do no more harm than a sheepنیک آدمی سے کِسی کو مُطلق نُقصان نہیں پہنچ سکتا
A lazy sheep thinks its wool heavyکاہل بھیڑ سمجھتی ہے اس پر اون کا بوجھ ہے
A rotten sheep infects the whole flockایک گندی مچھلی سارے جل کو گندہ کرتی ہے
A wolf in sheep clothingمنافق
As soon comes the lamb's skin to market as the old sheep'sموت کے ہاتھ کمان نہ بوڑھا بچے نہ جوان
Better give the wool than sheepسارا جاتا دیکھئے آدھا دیجئے بانٹ
View More ...

What are the meanings of Bheyr - بھیڑ in English?

Meanings of the word Bheyr - بھیڑ in English are crowd, ewe, gathering, huddle, mass, mob, rush, sheep, swarm, aggregation, caboodle, crowding, multitude, overcrowd, sheepish, wold, conges, congests, crowdie, crowdies, mong, overcrowds, sheepy, swarmings, swarms, throngs, tooled, wolds and heep. To understand how would you translate the word Bheyr - بھیڑ in English, you can take help from words closely related to Bheyr - بھیڑ or it’s English translations. Some of these words can also be considered Bheyr - بھیڑ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Bheyr - بھیڑ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Bheyr - بھیڑ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Bheyr - بھیڑ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Bheyr - بھیڑ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by bheyr?

Meanings of bheyr are crowd, ewe, gathering, huddle, mass, mob, rush, sheep, swarm, aggregation, caboodle, crowding, multitude, overcrowd, sheepish, wold, conges, congests, crowdie, crowdies, mong, overcrowds, sheepy, swarmings, swarms, throngs, tooled, wolds and heep

Whats the definition of bheyr?

Definition of the bheyr are

  • an informal body of friends
  • a large number of things or people considered together
  • fill or occupy to the point of overflowing
  • to gather together in large numbers
  • approach a certain age or speed
  • cause to herd, drive, or crowd together
  • female sheep
  • a member of a people living in southern Benin and Togo and southeastern Ghana
  • a Kwa language spoken by the Ewe in Ghana and Togo and Benin
  • the act of gathering something
  • sewing consisting of small folds or puckers made by pulling tight a thread in a line of stitching
  • a group of persons together in one place
  • the social act of assembling
  • a disorganized and densely packed crowd
  • crouch or curl up
  • crowd or draw together
  • (informal) a quick private conference
  • the property of something that is great in magnitude
  • (Roman Catholic Church and Protestant Churches) the celebration of the Eucharist
  • the property of a body that causes it to have weight in a gravitational field
  • a sequence of prayers constituting the Christian eucharistic rite
  • a musical setting for a Mass
  • an ill-structured collection of similar things (objects or people)
  • a body of matter without definite shape
  • the common people generally
  • join together into a mass or collect or form a mass
  • formed of separate units gathered into a mass or whole
  • (often followed by of') a large number or amount or extent
  • the act of moving hurriedly and in a careless manner
  • urge to an unnatural speed
  • act or move at high speed
  • cause to move fast or to rush or race
  • (American football) an attempt to advance the ball by running into the line
  • a sudden burst of activity
  • a sudden forceful flow
  • grasslike plants growing in wet places and having cylindrical often hollow stems
  • run with the ball, in football
  • attack suddenly
  • cause to occur rapidly
  • not accepting reservations
  • done under pressure
  • move hurridly
  • physician and American Revolutionary leader; signer of the Declaration of Independence (1745-1813)
  • woolly usually horned ruminant mammal related to the goat
  • a docile and vulnerable person who would rather follow than make an independent decision
  • a timid defenseless simpleton who is readily preyed upon
  • move in large numbers
  • be teeming, be abuzz
  • a group of many things in the air or on the ground
  • several things grouped together or considered as a whole
  • the act of gathering something together
  • any collection in its entirety
  • a situation in which people or things are crowded together
  • the common people generally
  • a large indefinite number
  • a large gathering of people
  • crowd together too much
  • cause to crowd together too much
  • showing a sense of shame
  • like or suggestive of a sheep in docility or stupidity or meekness or timidity
  • a tract of open rolling country (especially upland)
  • شہد کی مکیھوں کا دل یا لشکر جو پہلا چھتہ چھوڑ کر اپنی ملکہ کے ساتھ نیا گھر بنانے کو نکل پڑا ہو

What is the synonym of bheyr?

Synonym of word bheyr are جتھا, مجمع, ہجُوم, اَزدحام, جمِ غفیر, بھِیڑ, جَمگھَٹا, بھیڑ, فوج, انبوہ

What are the idioms related to bheyr?

Here are the idioms that are related to the word bheyr.

  • The mob has many heads but no brains
  • A mind moves the mass
  • Gathering wealth is a pleasant pain
  • I do not hunt for the suffrages of the inconstant multitude
  • Rolling stone gathers no mass

Paragraph Transliteration