Charhaa i - چڑھائ meanings in English
Charhaa i - چڑھائ meanings in English are ascendancy, ascent, assault, attack, climb, incursion, invasion, mounting, steep Charhaa i - چڑھائ in English. More meanings of charhaa i - چڑھائ, it's definitions, example sentences, related words, idioms and quotations.
ascendancy ascent assault attack climb incursion invasion mounting steep
Charhaa i - چڑھائ Definitions
Please find 46 English and 1 Urdu definitions related to the word Charhaa i - چڑھائ.
- (noun) : an upward slope or grade (as in a road)
- (noun) : an event that involves rising to a higher point (as in altitude or temperature or intensity etc.)
- (verb) : increase in value or to a higher point
- (verb) : improve one's social status
- (verb) : slope upward
- (verb) : move with difficulty, by grasping
- (noun) : framework used for support or display
- (noun) : an event that involves rising to a higher point (as in altitude or temperature or intensity etc.)
- (adjective satellite) : greatly exceeding bounds of reason or moderation
- (noun) : a steep place (as on a hill)
- (verb) : let sit in a liquid to extract a flavor or to cleanse
- (adjective satellite) : of a slope; set at a high angle
- (adjective) : having a sharp inclination
- (verb) : devote (oneself) fully to
- (noun) : the state that exists when one person or group has power over another
- (noun) : an upward slope or grade (as in a road)
- (noun) : a movement upward
- (noun) : the act of changing location in an upward direction
- (verb) : force (someone) to have sex against their will
- (verb) : attack in speech or writing
- (verb) : attack someone physically or emotionally
- (noun) : a threatened or attempted physical attack by someone who appears to be able to cause bodily harm if not stopped
- (noun) : close fighting during the culmination of a military attack
- (noun) : thoroughbred that won the triple crown in 1946
- (noun) : the crime of forcing a person to submit to sexual intercourse against his or her will
- (noun) : ideas or actions intended to deal with a problem or situation
- (noun) : intense adverse criticism
- (verb) : attack in speech or writing
- (verb) : take the initiative and go on the offensive
- (verb) : attack someone physically or emotionally
- (noun) : a decisive manner of beginning a musical tone or phrase
- (noun) : an offensive move in a sport or game
- (noun) : the act of attacking
- (noun) : (military) an offensive against an enemy (using weapons)
- (noun) : strong criticism
- (noun) : the onset of a corrosive or destructive process (as by a chemical agent)
- (noun) : a sudden occurrence of an uncontrollable condition
- (verb) : begin to injure
- (verb) : launch an attack or assault on; begin hostilities or start warfare with
- (verb) : set to work upon; turn one's energies vigorously to a task
- (noun) : the act of entering some territory or domain (often in large numbers)
- (noun) : the mistake of incurring liability or blame
- (noun) : an attack that penetrates into enemy territory
- (noun) : any entry into an area not previously occupied
- (noun) : (pathology) the spread of pathogenic microorganisms or malignant cells to new sites in the body
- (noun) : the act of invading; the act of an army that invades for conquest or plunder
- اوپر چڑھتا ھُوا یا نیچے اُترتا ھُوا
More words related to the meanings of Charhaa i - چڑھائ
More words from English related to Charhaa i - چڑھائ
View an extensive list of words below that are related to the meanings of the word Charhaa i - چڑھائ meanings in English in English.
abruptnesserectionliftaltitudeascentbeginningelevationeminenceexpensesnubilityswaggerabstrusedifficultembarrassmentirksomeobstaclepalacepinchpuzzlingthornyabstractarduouscomplicateddifficultydilemmahardhardshiphot waterintricacyintricatenarrowoccultoperosepainfulperplexityproblemsteeptangletenacioustortuoustoughtroubleuphillwearifulwearisomedifficilehardertuskydifficilitatedifficultate ... acmeclimaxascensionelationexaltationheightriserisingascendanceascendenceascendencyupriseascendentsascensionsprevalencyunfleshessublimificationaggressionraidassaultattackincursioninvasionirruptionoffenceoffensiveonfallonsetonslaughtstrokeassoilinvarianceassailedassailmentassaultsassoiledassoilmentassoilsattackedincursionsinvadesinvalidedassastioninvillagedaggrandizementculturefurtherancegrowthmultiplicationproficiencyprogressedstoppageadvancementclimbdevelopementheadwayprogresspromotiondevelopdevelopmentprogress toprogressionupliftupliftingadvancesoutdroveproggingprogradeprogressesstridesupgrowthupliftsprodigenceawfullygreatlygrosslyhugelymostovermuchparlousquiteseverelythoroughvastlyveryaboundingamplecopiousendexceedinglyexcessiveextremelyextremityhyperintenseintenselylastlimitrifeenhance horsemountoutflyoverswellascendcloakexcelincreaseridescalesoarascenderclimbingcliffygridingcollocationembellishmentequipmentfurnituregracefulnessmountingseemingnessarraydecorationgarniturenattinesstrappingstrimmingdeconcentratedecordecorousdecorousnessdecorticatedecorumdecurvedembouchureadorationsdecantsdecarbdecarbeddeclassesdecoratingdecoratorsdecorsdecorumsdecretorydecrowndecrownsdesorbeddesorbingdisfurnishmaintopsdecarbonizationdecarbonizeddecarbonizingdecarburizationdecarddecennariesdeconcentrationdecoramentdecoredecorementdecretedecrustationdecurtdecurtationdisfurnishingdisfurnishmentdisfurnituredisparkledortureornaturecrestacclivityaloftascendingexaltedloftyedificationflourishgarnisharrangementorderlinesspreparationencroachmentpragmatismaccessadmissioninterceptionintercurrenceinterferenceinterventionintrusioninterbredinterbreedinterbreedinginterferinginterreflectionintrustinterferesinterfusedinterfusesintermentsinterposedinterringintertiesinterveininterveinsintrusionsintrustedintrustsmeddledmeddlesintercentrumintercominginterdigitationinterduceinterferinglyinterfrettedintermentionintermigrationinterminationintervenienceinterveniencyintervenientinterventinterwreatheintreatanceintromittentengagemobbingsicassailchargego atinvadestormattackinggang upassailingassiegeassiegingencashinginvilegalaplumpnessmobilisationpreparednessprovisionreadinessprearrangementprefatorypreparativethreadyprepayspreflorationprepollencepreponderancypreponderationfinerybeautyestablishmentmenseornamentgrabscootbeatboundcatch a ballclawclutchdartflashhentlaunchmake hastepulsaterunsnapsnatchspringthroblippingfakefall uponmoblickblowlikeresemblingstabsmaraudraiderinrushrazziarampancyvehemenceascendancydominancedominationimpetuositybubblinessdominieomnipotencepredominancepredominationboulterdominancesdominancydominatesdominiesdominionsomnipotencyrampslantwisedeclivitydescendingdownhillprecipitousslantslantingslopingslopsslopesslopewiseslap dashwastefullywastefulnessblindingextravagantheadlongindiscriminateprecipitatelypromiscuousundiscriminatingviolentindiscreteindiscriminatelyindraughtindraughtsincindentalindigitatedindigitatingindiscriminativeindiscussedindispersedindisposingindisputedindoctrinateddepressionlowlow groundgallopinveighrebukerevileshoutsnubstabberstabbingsbullybullyingmenacethreatexcessoutrageviolencethrustfightscramblepenetratebedrenchdabbledrabblemoistenslakesteeperforay
Idioms related to the meaning of Charhaa i - چڑھائ
What are the meanings of Charhaa i - چڑھائ in English?
Meanings of the word Charhaa i - چڑھائ in English are climb, mounting, steep, ascendancy, ascent, assault, attack, incursion and invasion. To understand how would you translate the word Charhaa i - چڑھائ in English, you can take help from words closely related to Charhaa i - چڑھائ or it’s English translations. Some of these words can also be considered Charhaa i - چڑھائ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Charhaa i - چڑھائ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Charhaa i - چڑھائ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Charhaa i - چڑھائ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Charhaa i - چڑھائ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by charhaa i?
Meanings of charhaa i are climb, mounting, steep, ascendancy, ascent, assault, attack, incursion and invasion
Whats the definition of charhaa i?
Definition of the charhaa i are
- an upward slope or grade (as in a road)
- an event that involves rising to a higher point (as in altitude or temperature or intensity etc.)
- increase in value or to a higher point
- improve one's social status
- slope upward
- move with difficulty, by grasping
- framework used for support or display
- an event that involves rising to a higher point (as in altitude or temperature or intensity etc.)
- greatly exceeding bounds of reason or moderation
- a steep place (as on a hill)
- let sit in a liquid to extract a flavor or to cleanse
- of a slope; set at a high angle
- having a sharp inclination
- devote (oneself) fully to
- the state that exists when one person or group has power over another
- an upward slope or grade (as in a road)
- a movement upward
- the act of changing location in an upward direction
- force (someone) to have sex against their will
- attack in speech or writing
- attack someone physically or emotionally
- a threatened or attempted physical attack by someone who appears to be able to cause bodily harm if not stopped
- close fighting during the culmination of a military attack
- thoroughbred that won the triple crown in 1946
- the crime of forcing a person to submit to sexual intercourse against his or her will
- ideas or actions intended to deal with a problem or situation
- intense adverse criticism
- attack in speech or writing
- take the initiative and go on the offensive
- attack someone physically or emotionally
- a decisive manner of beginning a musical tone or phrase
- an offensive move in a sport or game
- the act of attacking
- (military) an offensive against an enemy (using weapons)
- strong criticism
- the onset of a corrosive or destructive process (as by a chemical agent)
- a sudden occurrence of an uncontrollable condition
- begin to injure
- launch an attack or assault on; begin hostilities or start warfare with
- set to work upon; turn one's energies vigorously to a task
- the act of entering some territory or domain (often in large numbers)
- the mistake of incurring liability or blame
- an attack that penetrates into enemy territory
- any entry into an area not previously occupied
- (pathology) the spread of pathogenic microorganisms or malignant cells to new sites in the body
- the act of invading; the act of an army that invades for conquest or plunder
- اوپر چڑھتا ھُوا یا نیچے اُترتا ھُوا
What is the synonym of charhaa i?
Synonym of word charhaa i are ترقی, چڑھنا, بلنگنا, چڑھائ, اوپر جانا, سجاوٹ, آراستگی, تیاری, زیبائش, تزین
What are the idioms related to charhaa i?
Here are the idioms that are related to the word charhaa i.
- He that would have the fruit must climb the tree
- You cannot climb a ladder by pushing others down