Dandi - ڈنڈی meanings in English
Dandi - ڈنڈی Definitions
Please find 50 English and 1 Urdu definitions related to the word Dandi - ڈنڈی.
- (verb) : to move or force, especially in an effort to get something open
- (noun) : a rigid bar pivoted about a fulcrum
- (noun) : a flat metal tumbler in a lever lock
- (noun) : a simple machine that gives a mechanical advantage when given a fulcrum
- (verb) : obstruct
- (noun) : a projecting piece that is used to lift or support or turn something
- (noun) : ancient Celtic god
- (noun) : marine worms having a row of tufted gills along each side of the back; often used for fishing bait
- (noun) : a sail with four corners that is hoisted from a yard that is oblique to the mast
- (verb) : carry with difficulty
- (noun) : the posterior part of the mandible that is more or less vertical
- (noun) : a gangster's pistol
- (noun) : a square rod of land
- (noun) : a linear measure of 16.5 feet
- (noun) : any rod-shaped bacterium
- (noun) : a long thin implement made of metal or wood
- (noun) : a visual receptor cell that is sensitive to dim light
- (noun) : framework consisting of stakes interwoven with branches to form a fence
- (noun) : a fleshy wrinkled and often brightly colored fold of skin hanging from the neck or throat of certain birds (chickens and turkeys) or lizards
- (verb) : interlace to form wattle
- (verb) : build of or with wattle
- (noun) : any of various Australasian trees yielding slender poles suitable for wattle
- (noun) : the appendage to an object that is designed to be held in order to use or move it
- (verb) : touch, lift, or hold with the hands
- (verb) : interact in a certain way
- (verb) : handle effectively
- (verb) : act on verbally or in some form of artistic expression
- (verb) : show and train
- (noun) : any of the larger wing or tail feathers of a bird
- (noun) : the hollow spine of a feather
- (noun) : a stiff hollow protective spine on a porcupine or hedgehog
- (noun) : pen made from a bird's feather
- (noun) : the body of teachers and administrators at a school
- (noun) : a strong rod or stick with a specialized utilitarian purpose
- (noun) : (music) the system of five horizontal lines on which the musical notes are written
- (noun) : a rod carried as a symbol
- (noun) : personnel who assist their superior in carrying out an assigned task
- (verb) : provide with staff
- (verb) : serve on the staff of
- (noun) : building material consisting of plaster and hair; used to cover external surfaces of temporary structure (as at an exposition) or for decoration
- (noun) : (linguistics) the form of a word after all affixes are removed
- (noun) : a slender or elongated structure that supports a plant or fungus or a plant part or plant organ
- (verb) : stop the flow of a liquid
- (noun) : front part of a vessel or aircraft
- (noun) : cylinder forming a long narrow part of something
- (noun) : the tube of a tobacco pipe
- (verb) : remove the stem from
- (verb) : cause to point inward
- (noun) : a turn made in skiing; the back of one ski is forced outward and the other ski is brought parallel to it
- (verb) : grow out of, have roots in, originate in
- دھات يا مُختَلِف مادّوں سے بَنی ہُوئی چھَڑی يا سُلاخ
More words related to the meanings of Dandi - ڈنڈی
More words from English related to Dandi - ڈنڈی
View an extensive list of words below that are related to the meanings of the word Dandi - ڈنڈی meanings in English in English.
abutfeel fingerfumblepighandhandletouchtouch upbludgeonleverbatclubcudgelquarterstaffrodtruncheonbingerstingraystegbutfeather fulloverpinionaboveatbladechargedcompletedownfraught howeverinladenleafonplumequillstillstrengththroughuponwingyetcanewalker staffwandbatonwalking stick ... wattlecaniculecanticleparoquetstickpinstickweedwalkingstickcanticoyreedingsroddingrodingrodsroksroodsstickjawstickjawswandsparquetagegoadstaffvergemacesceptreclutchencroachmentgraspgripholdkeepingmanubriummasteryoccupancyoccupationtenurehafthilthingeholdingknuckle jointpossessingpossessionpowerseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivaldragdraweduce trailabsorbbrewdistildrag longhaullugpullstripdistilldraw awayintrenchmentpull uppullingpullulateratchsnarl upstragglingstretchingcrampingscatchdretcheretationintrenchingpruinatepullenscribblesnaketrektugdraggingdrogue chutedragglingdraggyearminequarryearedeardingeardsearskankan.goshgoosishearlobeestablishmentpersonnelcrewworkerclewcrechecrewetcrewmangeneral staffcrevicescrewecrewedcrewelcrewelscrewingcrewmencrewsstaffagestaffedstaffingstaffierstaffishstaffmenferrulehooploopringgigteetotumspindlewhirligigobjectiontakingvalencyclampcriticismgrapplegripelockseizinggripesgripinggrippingcapturinggrabsgracinggraipgraipsgrapinggraspergraspsgrikegripedgrippergripsgripplenesshornramustineboughbranchcornuoffshootsectionspraystalestalkbrankknitbecomegathergetpluckpretendselectshamstitchswankweavebecomingnessknishknitworkknitchesknittlepropshoretaxonlaverleaverlaversleaversleverslivreattachmentcandle flameexpectationhopelooloughluloweosierphysicianrattanwickerwillowyardpierpillarspilecolumnmastpolepoststakepoledtwiglocustaetwiggentwiggerbasketdalidollytrowstattabennetbentypipetapelinetubagetubectomytapinagenewelsstem
Idioms related to the meaning of Dandi - ڈنڈی
What are the meanings of Dandi - ڈنڈی in English?
Meanings of the word Dandi - ڈنڈی in English are lever, lug, ramus, rod, wattle, handle, quill, staff, stem and dandi. To understand how would you translate the word Dandi - ڈنڈی in English, you can take help from words closely related to Dandi - ڈنڈی or it’s English translations. Some of these words can also be considered Dandi - ڈنڈی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Dandi - ڈنڈی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Dandi - ڈنڈی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Dandi - ڈنڈی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Dandi - ڈنڈی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by dandi?
Meanings of dandi are lever, lug, ramus, rod, wattle, handle, quill, staff, stem and dandi
Whats the definition of dandi?
Definition of the dandi are
- to move or force, especially in an effort to get something open
- a rigid bar pivoted about a fulcrum
- a flat metal tumbler in a lever lock
- a simple machine that gives a mechanical advantage when given a fulcrum
- obstruct
- a projecting piece that is used to lift or support or turn something
- ancient Celtic god
- marine worms having a row of tufted gills along each side of the back; often used for fishing bait
- a sail with four corners that is hoisted from a yard that is oblique to the mast
- carry with difficulty
- the posterior part of the mandible that is more or less vertical
- a gangster's pistol
- a square rod of land
- a linear measure of 16.5 feet
- any rod-shaped bacterium
- a long thin implement made of metal or wood
- a visual receptor cell that is sensitive to dim light
- framework consisting of stakes interwoven with branches to form a fence
- a fleshy wrinkled and often brightly colored fold of skin hanging from the neck or throat of certain birds (chickens and turkeys) or lizards
- interlace to form wattle
- build of or with wattle
- any of various Australasian trees yielding slender poles suitable for wattle
- the appendage to an object that is designed to be held in order to use or move it
- touch, lift, or hold with the hands
- interact in a certain way
- handle effectively
- act on verbally or in some form of artistic expression
- show and train
- any of the larger wing or tail feathers of a bird
- the hollow spine of a feather
- a stiff hollow protective spine on a porcupine or hedgehog
- pen made from a bird's feather
- the body of teachers and administrators at a school
- a strong rod or stick with a specialized utilitarian purpose
- (music) the system of five horizontal lines on which the musical notes are written
- a rod carried as a symbol
- personnel who assist their superior in carrying out an assigned task
- provide with staff
- serve on the staff of
- building material consisting of plaster and hair; used to cover external surfaces of temporary structure (as at an exposition) or for decoration
- (linguistics) the form of a word after all affixes are removed
- a slender or elongated structure that supports a plant or fungus or a plant part or plant organ
- stop the flow of a liquid
- front part of a vessel or aircraft
- cylinder forming a long narrow part of something
- the tube of a tobacco pipe
- remove the stem from
- cause to point inward
- a turn made in skiing; the back of one ski is forced outward and the other ski is brought parallel to it
- grow out of, have roots in, originate in
- دھات يا مُختَلِف مادّوں سے بَنی ہُوئی چھَڑی يا سُلاخ
What is the synonym of dandi?
Synonym of word dandi are ڈنڈا, ٹیکن, اٹھنگن, ڈنڈی, بیرم, لیور, کھینچنا, گھسیٹنا, کان, گوش
What are the idioms related to dandi?
Here are the idioms that are related to the word dandi.
- If the staff be crooked the shadow cannot be straight
- Lug in
- To handle with kid gloves
- To throw the handle after the lost hatchet
- Women and workmen are difficult to handle