Ghaa eb ho jaana - غائب ہو جانا meanings in English
Ghaa eb ho jaana - غائب ہو جانا meanings in English are disappear, evaporate, evanesce, clear out, decamp, flee, vapourise Ghaa eb ho jaana - غائب ہو جانا in English. More meanings of ghaa eb ho jaana - غائب ہو جانا, it's definitions, example sentences, related words, idioms and quotations.
disappear evaporate evanesce clear out decamp flee vapourise
Ghaa eb ho jaana - غائب ہو جانا Definitions
Please find 16 English and definitions related to the word Ghaa eb ho jaana - غائب ہو جانا.
- (verb) : become invisible or unnoticeable
- (verb) : become less intense and fade away gradually
- (verb) : cease to exist
- (verb) : get lost, as without warning or explanation
- (verb) : become less intense and fade away gradually
- (verb) : lose or cause to lose liquid by vaporization leaving a more concentrated residue
- (verb) : change into a vapor
- (verb) : cause to change into a vapor
- (verb) : disappear gradually
- (verb) : run away quickly
- (verb) : empty completely
- (verb) : clear out the chest and lungs
- (verb) : move out and leave nothing behind
- (verb) : run away; usually includes taking something or somebody along
- (verb) : leave suddenly
- (verb) : leave a camp
More words related to the meanings of Ghaa eb ho jaana - غائب ہو جانا
More words from English related to Ghaa eb ho jaana - غائب ہو جانا
View an extensive list of words below that are related to the meanings of the word Ghaa eb ho jaana - غائب ہو جانا meanings in English in English.
abscondfleeescapelevantscamperskedaddledecampmizzlerun awayvamoserun offrush awayelopingfleaghdisappearevanescemissuccessfleetfadevanishvanishmentabearanceabsentationabsentnessevanishmentoutskipflitfleakdrive racerunbreak awaybreakawayspear upfleighleavemarchevaporatevapourgageimportunejibleapobstructwaftwageflypersistblow flyfleawort ... fling offflyblownfleyingfliersflingingfliskingflockingflypeflypingflyteflytingflywheelsdriftpiecedriftwindfleenfleetenfly catchingevaporationvapourisetakeoffclear outdepartget gohideretreat
Idioms related to the meaning of Ghaa eb ho jaana - غائب ہو جانا
What are the meanings of Ghaa eb ho jaana - غائب ہو جانا in English?
Meanings of the word Ghaa eb ho jaana - غائب ہو جانا in English are disappear, evaporate, evanesce, flee, clear out, decamp and vapourise. To understand how would you translate the word Ghaa eb ho jaana - غائب ہو جانا in English, you can take help from words closely related to Ghaa eb ho jaana - غائب ہو جانا or it’s English translations. Some of these words can also be considered Ghaa eb ho jaana - غائب ہو جانا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Ghaa eb ho jaana - غائب ہو جانا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Ghaa eb ho jaana - غائب ہو جانا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Ghaa eb ho jaana - غائب ہو جانا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Ghaa eb ho jaana - غائب ہو جانا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ghaa eb ho jaana?
Meanings of ghaa eb ho jaana are disappear, evaporate, evanesce, flee, clear out, decamp and vapourise
Whats the definition of ghaa eb ho jaana?
Definition of the ghaa eb ho jaana are
- become invisible or unnoticeable
- become less intense and fade away gradually
- cease to exist
- get lost, as without warning or explanation
- become less intense and fade away gradually
- lose or cause to lose liquid by vaporization leaving a more concentrated residue
- change into a vapor
- cause to change into a vapor
- disappear gradually
- run away quickly
- empty completely
- clear out the chest and lungs
- move out and leave nothing behind
- run away; usually includes taking something or somebody along
- leave suddenly
- leave a camp
What is the synonym of ghaa eb ho jaana?
Synonym of word ghaa eb ho jaana are اوجھل ہو جانا, کھو جانا, غائب ہو جانا, الوپ ہونا, غائب ہونا, جاتا رہنا, اڑ جانا, انتر دھیان ہونا, نظروں سے جاتا رہنا, دکھائی
What are the idioms related to ghaa eb ho jaana?
Here are the idioms that are related to the word ghaa eb ho jaana.
- Do not flee conversation nor let your door be always shut
- Flee for one life
- Flee never so fast your fortune will be at your tail
- Flee for ones life