Ibaarat - عبارت meanings in English
Ibaarat - عبارت meanings in English are context, wordage, phrase, expression, composition, wording, style, passage, narration, inscription, diction, phraseology, writing Ibaarat - عبارت in English. More meanings of ibaarat - عبارت, it's definitions, example sentences, related words, idioms and quotations.
context wordage phrase expression composition wording style passage narration inscription diction phraseology writing
Ibaarat - عبارت Definitions
Please find 59 English and 1 Urdu definitions related to the word Ibaarat - عبارت.
- (noun) : discourse that surrounds a language unit and helps to determine its interpretation
- (noun) : the way in which someone or something is composed
- (noun) : something that is created by arranging several things to form a unified whole
- (noun) : the spatial property resulting from the arrangement of parts in relation to each other and to the whole
- (noun) : an essay (especially one written as an assignment)
- (noun) : a mixture of ingredients
- (noun) : musical creation
- (noun) : art and technique of printing with movable type
- (noun) : the act of creating written works
- (noun) : the passing of a law by a legislative body
- (noun) : the act of passing from one state or place to the next
- (noun) : a journey usually by ship
- (noun) : the act of passing something to another person
- (noun) : a way through or along which someone or something may pass
- (noun) : a path or channel or duct through or along which something may pass
- (noun) : a section of text; particularly a section of medium length
- (noun) : a short section of a musical composition
- (noun) : the motion of one object relative to another
- (noun) : a bodily reaction of changing from one place or stage to another
- (verb) : put into words or an expression
- (noun) : an expression whose meanings cannot be inferred from the meanings of the words that make it up
- (noun) : a short musical passage
- (noun) : dance movements that are linked in a single choreographic sequence
- (noun) : an expression consisting of one or more words forming a grammatical constituent of a sentence
- (verb) : divide, combine, or mark into phrases
- (noun) : the manner in which something is expressed in words
- (noun) : the manner in which something is expressed in words
- (noun) : the articulation of speech regarded from the point of view of its intelligibility to the audience
- (noun) : a group of words that form a constituent of a sentence and are considered as a single unit
- (noun) : expression without words
- (noun) : a word or phrase that particular people use in particular situations
- (noun) : the feelings expressed on a person's face
- (noun) : the act of forcing something out by squeezing or pressing
- (noun) : a group of symbols that make a mathematical statement
- (noun) : the style of expressing yourself
- (noun) : the communication (in speech or writing) of your beliefs or opinions
- (noun) : (genetics) the process of expressing a gene
- (noun) : a short message (as in a book or musical work or on a photograph) dedicating it to someone or something
- (noun) : the activity of inscribing (especially carving or engraving) letters or words
- (noun) : letters inscribed (especially words engraved or carved) on something
- (noun) : the act of giving an account describing incidents or a course of events
- (noun) : (rhetoric) the second section of an oration in which the facts are set forth
- (noun) : distinctive and stylish elegance
- (verb) : designate by an identifying term
- (noun) : the popular taste at a given time
- (noun) : a way of expressing something (in language or art or music etc.) that is characteristic of a particular person or group of people or period
- (noun) : a slender bristlelike or tubular process
- (noun) : a pointed tool for writing or drawing or engraving
- (noun) : a particular kind (as to appearance)
- (noun) : editorial directions to be followed in spelling and punctuation and capitalization and typographical display
- (noun) : (botany) the narrow elongated part of the pistil between the ovary and the stigma
- (verb) : make consistent with certain rules of style
- (verb) : make consistent with a certain fashion or style
- (noun) : the manner in which something is expressed in words
- (noun) : the act of creating written works
- (noun) : the activity of putting something in written form
- (noun) : letters or symbols that are written or imprinted on a surface to represent the sounds or words of a language
- (noun) : (usually plural) the collected work of an author
- (noun) : the work of a writer; anything expressed in letters of the alphabet (especially when considered from the point of view of style and effect)
- کِسی مادّے کے عناصر جِن سے مِل کر وہ بنا ہو اور اِن میں سے ہر ایک کا تناسُب
More words related to the meanings of Ibaarat - عبارت
More words from English related to Ibaarat - عبارت
View an extensive list of words below that are related to the meanings of the word Ibaarat - عبارت meanings in English in English.
accesscarrotentrancewayadmissionegresspassagepassingtravelaccentuationgetupmienmodegenremannerstyletypedistylesguisesstyletsstypticsaffirmationavowaldissertationeclaircissementillustrationstatementaccountallegationarticleclearconspicousdeclarationdescriptiondetaildistinct evidentexplanationmanifestationnarrationspeechdelineatedexplicationdescribingepitriteoutlastedperorateddecorticatedexauthorationstateprison ... discussion epigraphparlancecompositiondiscourseobjectionorationpoetryair cellcrevice crannyholeleakmortiseopeningventborehollowinletmouthvacancyperforatedperforationholesopeningsostiolesceremonialcraftgadgetmachinationmanoeuvremotionmovemovementspeedstepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackchirographycalligraphycopyingwritingbibliomancyclichephrasevertebrawisecrackcolourcolouringcolordyehuemoodpigmentsuffusedvarnishappearanceaspectchromaenjoymentpainttincttincturevatcolorscoloursdyeshuescomedycomfitcopycounterpartfablegesticulationmimerymockpersonagespoofetaleactinganecdoteapingcounterfeitexemplarimitatingimitationimpersonationmimickingmimicrymockernarrativeprintreplicareproductionsimulationstorytranscripttransferduplicabilityduplicableduplicatablereduplicationreplicationtranscribedduplicatedreplicatescentuplicateconduplicateconduplicationduplicatureinduplicatereplicantcontextpurportspurporttenoragreementarrangementconnectionmethodordersystemeducationcorrespondentepistlepacifierlettertreatiseconfigurationfigureguisemoralbehaviourcharacterchiccuttingdemeanourfoundinggarbnatureposturesituationstancestatevoguemodiusmodussceattdiploma bookdeeddocumentmunimentdocitydialect idiomidiotismphraseologyexpressionhabitphraselogypracticeusagedidacticaldidacticsidiolatryidiomaticalidiographidiographsidiolectalidiophonepreverbpreverbalproverbialismproverbializeemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentepitaph gravestoneheadstoneessayessaysformulary composingdictionfacetadvantagedirectionflankfrontleveragesidewingaspectualonsidesidesaddlefaceteaspectionfacetteside takingside wheelfictionforeclosureligationbondconstraintlimitationobstructionplanqualmrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationmakemodishnesspathwaytechniquebreedinglawmodus operanditactthringchurlishgeometryinditementcomponecomposeswristerwritabilityglorymagnificencemajestyconditiondignityeleganceeminencegrandeurpomppowershanshawnseanmakingmixturesynthesistemperconstructiondecoctioninventionrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmigrationtontoneveindesignformfoundation superiorsurpassinghigh fashionroutinenavigationvoyagesvoyagecruisesvoyagedsentencepromenadetrackhabitudefuriestraditionconventiondictumlegendsayingconventionalismconventionalitytraditionalitytraditionlismscripturebook upboobookthbookchaptercompanyinclusionparticipationwithincoherencecontextualismconcoursesconteckcontessacontextscontexturecontexwordageauthorshipauthoringmyographyoreographywritershipabirritationauthotypegraphicnesskindknackmannerismdismembermentrecisionshapeterraintractsealwording
Idioms related to the meaning of Ibaarat - عبارت
What are the meanings of Ibaarat - عبارت in English?
Meanings of the word Ibaarat - عبارت in English are context, composition, passage, phrase, phraseology, diction, expression, inscription, narration, style, wording, writing and wordage. To understand how would you translate the word Ibaarat - عبارت in English, you can take help from words closely related to Ibaarat - عبارت or it’s English translations. Some of these words can also be considered Ibaarat - عبارت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Ibaarat - عبارت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Ibaarat - عبارت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Ibaarat - عبارت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Ibaarat - عبارت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ibaarat?
Meanings of ibaarat are context, composition, passage, phrase, phraseology, diction, expression, inscription, narration, style, wording, writing and wordage
Whats the definition of ibaarat?
Definition of the ibaarat are
- discourse that surrounds a language unit and helps to determine its interpretation
- the way in which someone or something is composed
- something that is created by arranging several things to form a unified whole
- the spatial property resulting from the arrangement of parts in relation to each other and to the whole
- an essay (especially one written as an assignment)
- a mixture of ingredients
- musical creation
- art and technique of printing with movable type
- the act of creating written works
- the passing of a law by a legislative body
- the act of passing from one state or place to the next
- a journey usually by ship
- the act of passing something to another person
- a way through or along which someone or something may pass
- a path or channel or duct through or along which something may pass
- a section of text; particularly a section of medium length
- a short section of a musical composition
- the motion of one object relative to another
- a bodily reaction of changing from one place or stage to another
- put into words or an expression
- an expression whose meanings cannot be inferred from the meanings of the words that make it up
- a short musical passage
- dance movements that are linked in a single choreographic sequence
- an expression consisting of one or more words forming a grammatical constituent of a sentence
- divide, combine, or mark into phrases
- the manner in which something is expressed in words
- the manner in which something is expressed in words
- the articulation of speech regarded from the point of view of its intelligibility to the audience
- a group of words that form a constituent of a sentence and are considered as a single unit
- expression without words
- a word or phrase that particular people use in particular situations
- the feelings expressed on a person's face
- the act of forcing something out by squeezing or pressing
- a group of symbols that make a mathematical statement
- the style of expressing yourself
- the communication (in speech or writing) of your beliefs or opinions
- (genetics) the process of expressing a gene
- a short message (as in a book or musical work or on a photograph) dedicating it to someone or something
- the activity of inscribing (especially carving or engraving) letters or words
- letters inscribed (especially words engraved or carved) on something
- the act of giving an account describing incidents or a course of events
- (rhetoric) the second section of an oration in which the facts are set forth
- distinctive and stylish elegance
- designate by an identifying term
- the popular taste at a given time
- a way of expressing something (in language or art or music etc.) that is characteristic of a particular person or group of people or period
- a slender bristlelike or tubular process
- a pointed tool for writing or drawing or engraving
- a particular kind (as to appearance)
- editorial directions to be followed in spelling and punctuation and capitalization and typographical display
- (botany) the narrow elongated part of the pistil between the ovary and the stigma
- make consistent with certain rules of style
- make consistent with a certain fashion or style
- the manner in which something is expressed in words
- the act of creating written works
- the activity of putting something in written form
- letters or symbols that are written or imprinted on a surface to represent the sounds or words of a language
- (usually plural) the collected work of an author
- the work of a writer; anything expressed in letters of the alphabet (especially when considered from the point of view of style and effect)
- کِسی مادّے کے عناصر جِن سے مِل کر وہ بنا ہو اور اِن میں سے ہر ایک کا تناسُب
What is the synonym of ibaarat?
Synonym of word ibaarat are قرینہ, عبارت, لکھائی, سياق و سباق, سياق عبارت, عبارت سے متعلق, سیاق و سباق, کلام, اجزاۓ ترکیبی, ترکیب کیمیائی
What are the idioms related to ibaarat?
Here are the idioms that are related to the word ibaarat.
- In simple phrase
- Oblique narration or speech
- Unless context otherwise requires
- Bird of passage
- Passage of arms