Izteraab - اضطراب meanings in English

Izteraab - اضطراب meanings in English are uphasp, inflexures, dispirits, dismals, dismality, deflexions, deflexing, deflexes, deflexed, deflex, asthore, nervations, perplexes, reflexes, perplexiveness, inconcerning, disquietment, dispiritment, dismastment, disheriting, derogatoriness, deiformity, worrywarts, reflexions, anxieties, agogics, aggraces, turmoil, seethe, restlessness, perturbation, inquietude, anxiety, wavering, impatience, hurry, edginess, uneasiness, worriment, anergy, affricates, refractoriness, refractile, reflexion, reflexed, dispiritedness, disconcertment, disconcertion, aphakic, anxiolytic, disturbance Izteraab - اضطراب in English. More meanings of izteraab - اضطراب, it's definitions, example sentences, related words, idioms and quotations.

uphasp inflexures dispirits dismals dismality deflexions deflexing deflexes deflexed deflex asthore nervations perplexes reflexes perplexiveness inconcerning disquietment dispiritment dismastment disheriting derogatoriness deiformity worrywarts reflexions anxieties agogics aggraces turmoil seethe restlessness perturbation inquietude anxiety wavering impatience hurry edginess uneasiness worriment anergy affricates refractoriness refractile reflexion reflexed dispiritedness disconcertment disconcertion aphakic anxiolytic disturbance

Install chrome extension

Izteraab - اضطراب Definitions

Please find 62 English and definitions related to the word Izteraab - اضطراب.

  • (noun) : the act of disturbing something or someone; setting something in motion
  • (noun) : an unhappy and worried mental state
  • (noun) : electrical or acoustic activity that can disturb communication
  • (noun) : (psychiatry) a psychological disorder of thought or emotion; a more neutral term than mental illness
  • (noun) : activity that is a malfunction, intrusion, or interruption
  • (noun) : feelings of anxiety that make you tense and irritable
  • (noun) : a condition of urgency making it necessary to hurry
  • (noun) : the act of moving hurriedly and in a careless manner
  • (noun) : overly eager speed (and possible carelessness)
  • (verb) : urge to an unnatural speed
  • (verb) : move very fast
  • (verb) : act or move at high speed
  • (noun) : a dislike of anything that causes delay
  • (noun) : a restless desire for change and excitement
  • (noun) : a lack of patience; irritation with anything that causes delay
  • (verb) : be noisy with activity
  • (verb) : boil vigorously
  • (verb) : foam as if boiling
  • (verb) : be in an agitated emotional state
  • (noun) : disturbance usually in protest
  • (noun) : a violent disturbance
  • (noun) : violent agitation
  • (adjective satellite) : uncertain in purpose or action
  • (noun) : indecision in speech or action
  • (noun) : the quality of being unsteady and subject to changes
  • (noun) : a difficulty that causes anxiety
  • (noun) : inactivity and lack of energy
  • (noun) : reduction or lack of an immune response to a specific antigen
  • (noun) : a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune
  • (noun) : (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic
  • (noun) : a tranquilizer used to relieve anxiety and reduce tension and irritability
  • (adjective) : anxiety relieving
  • (adjective) : of or relating to or afflicted with aphakia
  • (noun) : someone afflicted by aphakia; someone lacking the natural lenses of the eyes
  • (noun) : anxious embarrassment
  • (noun) : anxious embarrassment
  • (noun) : a feeling of low spirits
  • (noun) : feelings of anxiety that make you tense and irritable
  • (noun) : an unhappy and worried mental state
  • (noun) : the act of causing disorder
  • (noun) : a disposition that is confused or nervous and upset
  • (noun) : (physics) a secondary influence on a system that causes it to deviate slightly
  • (noun) : activity that is a malfunction, intrusion, or interruption
  • (adjective satellite) : (of leaves) bent downward and outward more than 90 degrees
  • (noun) : expression without words
  • (noun) : a remark expressing careful consideration
  • (noun) : the image of something as reflected by a mirror (or other reflective material)
  • (noun) : a likeness in which left and right are reversed
  • (noun) : the ability to reflect beams or rays
  • (noun) : the phenomenon of a propagating wave (light or sound) being thrown back from a surface
  • (noun) : a calm, lengthy, intent consideration
  • (adjective) : of or relating to or capable of refraction
  • (noun) : the trait of being unmanageable
  • (noun) : a feeling of agitation expressed in continual motion
  • (noun) : a lack of patience; irritation with anything that causes delay
  • (noun) : inability to rest or relax or be still
  • (noun) : the quality of being ceaselessly moving or active
  • (noun) : the trait of seeming ill at ease
  • (noun) : feelings of anxiety that make you tense and irritable
  • (noun) : physical discomfort (as mild sickness or depression)
  • (noun) : inability to rest or relax or be still
  • (noun) : embarrassment deriving from the feeling that others are critically aware of you

More words related to the meanings of Izteraab - اضطراب

Disturbanceپریشانی pareyshaani پریشانی preyshaani پریشانی Pareshani خلل khalal اضطراب izteraab اضطراب iztiraab افراتفری afra tafri افراتفری Afratafree کھلبلی khalbali کھلبلی Khalbuli آشوب aashob آشوب Ashoob گڑ بڑ gar bar فساد fasaad ہنگامہ hangaamah ہنگامہ hangaamh ہنگامہ Hungama ہرج harj شور شرابا shor sharaaba شورش shorish الٹ پلٹ ulat pulat الٹ پلٹ ulat palat
Edginessاضطراب izteraab اضطراب iztiraab چڑچڑا پن
Hurryجلدی کرنا jaldi karna شتابی کرنا تعجیل کرنا جلدی jildi جلدی jaldi شتابی shitaabi شتابی Shatabi ہڑبڑی Harbari کھلبلی khalbali کھلبلی Khalbuli اضطرابی Izteraabi عجلت ujlat عجلت ajlat تعجیل Taajeel تیزی teyzi تیزی Tezi تیزی Taizi بیتابی Betaabi اشتیاق ishteyaaq اشتیاق ishtiyaaq اشتیاق Ishteaaq اشتیاق Itheiaq اضطراب izteraab اضطراب iztiraab عجلت کرنا ajlat karna بھاگ دوڑ کرنا bhaag daur karna ہڑبڑانا har baraana بھاگ دوڑ bhaag daur ہڑبڑاہٹ har baraahat
Impatienceبے صبری bey sabri اضطراب izteraab اضطراب iztiraab ناشیکبائی Nasheekbayi بے تابی بے قراری bey qaraari بے چینی bey chaeni
Seetheابالنا ubaalna اسننا Asnanaa اسیجنا Aseejna جوش دینا josh deyna کھولانا khaulaana ابال کر پکانا ubaal kar pakaana ابلنا ubalna کھولنا khaulna کھولنا kholna ہیجان haejaan ہیجان Pehchan کھولاہٹ khaulaahat اضطراب izteraab اضطراب iztiraab
Turmoilکھَلبَلی Khulbuli شَدید ہَل چَل ہَنگامَہ Hamgama افراتَفری کی حالَت خَرخَشَہ Kharkhasha ہلچل hal chal ہلچل Halchal ہنگامہ hangaamah ہنگامہ hangaamh ہنگامہ Hungama اضطراب izteraab اضطراب iztiraab کھلبلی khalbali کھلبلی Khalbuli پکار pukaar قیامت qeyaamat قیامت Qayamat شغب shaghab شغب Shughab شور shor تلاطم talaatum ادھم udham
Waveringشش و پنج shash o panj اضطراب izteraab اضطراب iztiraab بے چینی bey chaeni تردد taraddud دبدھا Dabdha دو دلا do dila متردد mutaraddid متزلزل mutazalzal مذبذب muzabzab مذبذب muzab zab مذبذب Mazbazab ڈانواں ڈول daanwaan dol ہچر مچر hichar michar ہچکچاہٹ hich kichaahat ہچکچاہٹ Hichkechaahat
Worrimentبول چال پَريشانی مُصيبَت مُشکِل mushkil تَشويش Tashwish دِقَّت اضطراب izteraab اضطراب iztiraab پریشانی pareyshaani پریشانی preyshaani پریشانی Pareshani
Anergyاضطراب izteraab اضطراب iztiraab
Anxietyاندوہ andoh فکر fikr فکر Fikar فراق firaaq فراق Firaq اضطراب izteraab اضطراب iztiraab غصہ ghussah غصہ Ghussa کاہش kaahish خلش khalish خلش Khalash خلش Khalush کھٹکا khatka پریشانی pareyshaani پریشانی preyshaani پریشانی Pareshani پرواہ parwaah پرواہ par waah
Anxiolyticاضطراب izteraab اضطراب iztiraab
Aphakicاضطراب izteraab اضطراب iztiraab
Disconcertionاضطراب izteraab اضطراب iztiraab
Disconcertmentاضطراب izteraab اضطراب iztiraab
Dispiritednessاضطراب izteraab اضطراب iztiraab
Inquietudeبے آرامی bey aaraami بے چینی bey chaeni بے کلی bey kali اضطراب izteraab اضطراب iztiraab تشویش tashwiish تشویش Tashvish تشویش Tashweesh
Perturbationدغدغہ dagh daghah گھبراہٹ ghabraahat گھبراہٹ Ghubrahat اضطراب izteraab اضطراب iztiraab
Reflexedاضطراب izteraab اضطراب iztiraab
Reflexionاضطراب izteraab اضطراب iztiraab
Refractileاضطراب izteraab اضطراب iztiraab
Refractorinessاضطراب izteraab اضطراب iztiraab
Restlessnessبے چینی bey chaeni اضطراب izteraab اضطراب iztiraab کسمساہٹ kasmsaahat پیچ و تاب peych o taab شتابی shitaabi شتابی Shatabi الجھن uljhan
Uneasinessبے چینی bey chaeni بے کلی bey kali گھبراہٹ ghabraahat گھبراہٹ Ghubrahat اضطراب izteraab اضطراب iztiraab پریشانی pareyshaani پریشانی preyshaani پریشانی Pareshani
Affricatesاضطراب izteraab اضطراب iztiraab
Aggracesاضطراب izteraab اضطراب iztiraab
Agogicsاضطراب izteraab اضطراب iztiraab
Anxietiesاضطراب izteraab اضطراب iztiraab
Asthoreاضطراب izteraab اضطراب iztiraab
Deflexاضطراب izteraab اضطراب iztiraab
Deflexedاضطراب izteraab اضطراب iztiraab
Deflexesاضطراب izteraab اضطراب iztiraab
Deflexingاضطراب izteraab اضطراب iztiraab
Deflexionsاضطراب izteraab اضطراب iztiraab
Dismalityاضطراب izteraab اضطراب iztiraab
Dismalsاضطراب izteraab اضطراب iztiraab
Dispiritsاضطراب izteraab اضطراب iztiraab
Inflexuresاضطراب izteraab اضطراب iztiraab
Nervationsاضطراب izteraab اضطراب iztiraab
Perplexesاضطراب izteraab اضطراب iztiraab
Reflexesاضطراب izteraab اضطراب iztiraab
Reflexionsاضطراب izteraab اضطراب iztiraab
Worrywartsاضطراب izteraab اضطراب iztiraab
Deiformityاضطراب izteraab اضطراب iztiraab
Derogatorinessاضطراب izteraab اضطراب iztiraab
Disheritingاضطراب izteraab اضطراب iztiraab
Dismastmentاضطراب izteraab اضطراب iztiraab
Dispiritmentاضطراب izteraab اضطراب iztiraab
Disquietmentاضطراب izteraab اضطراب iztiraab
Inconcerningاضطراب izteraab اضطراب iztiraab
Perplexivenessاضطراب izteraab اضطراب iztiraab
Uphaspاضطراب izteraab اضطراب iztiraab

More words from English related to Izteraab - اضطراب

View an extensive list of words below that are related to the meanings of the word Izteraab - اضطراب meanings in English in English.

abluvionflowanxietycareconcerndesireheedcaressedacerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpediteness ...

What are the meanings of Izteraab - اضطراب in English?

Meanings of the word Izteraab - اضطراب in English are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp. To understand how would you translate the word Izteraab - اضطراب in English, you can take help from words closely related to Izteraab - اضطراب or it’s English translations. Some of these words can also be considered Izteraab - اضطراب synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Izteraab - اضطراب. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Izteraab - اضطراب in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Izteraab - اضطراب in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Izteraab - اضطراب with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by izteraab?

Meanings of izteraab are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp

Whats the definition of izteraab?

Definition of the izteraab are

  • the act of disturbing something or someone; setting something in motion
  • an unhappy and worried mental state
  • electrical or acoustic activity that can disturb communication
  • (psychiatry) a psychological disorder of thought or emotion; a more neutral term than mental illness
  • activity that is a malfunction, intrusion, or interruption
  • feelings of anxiety that make you tense and irritable
  • a condition of urgency making it necessary to hurry
  • the act of moving hurriedly and in a careless manner
  • overly eager speed (and possible carelessness)
  • urge to an unnatural speed
  • move very fast
  • act or move at high speed
  • a dislike of anything that causes delay
  • a restless desire for change and excitement
  • a lack of patience; irritation with anything that causes delay
  • be noisy with activity
  • boil vigorously
  • foam as if boiling
  • be in an agitated emotional state
  • disturbance usually in protest
  • a violent disturbance
  • violent agitation
  • uncertain in purpose or action
  • indecision in speech or action
  • the quality of being unsteady and subject to changes
  • a difficulty that causes anxiety
  • inactivity and lack of energy
  • reduction or lack of an immune response to a specific antigen
  • a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune
  • (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic
  • a tranquilizer used to relieve anxiety and reduce tension and irritability
  • anxiety relieving
  • of or relating to or afflicted with aphakia
  • someone afflicted by aphakia; someone lacking the natural lenses of the eyes
  • anxious embarrassment
  • anxious embarrassment
  • a feeling of low spirits
  • feelings of anxiety that make you tense and irritable
  • an unhappy and worried mental state
  • the act of causing disorder
  • a disposition that is confused or nervous and upset
  • (physics) a secondary influence on a system that causes it to deviate slightly
  • activity that is a malfunction, intrusion, or interruption
  • (of leaves) bent downward and outward more than 90 degrees
  • expression without words
  • a remark expressing careful consideration
  • the image of something as reflected by a mirror (or other reflective material)
  • a likeness in which left and right are reversed
  • the ability to reflect beams or rays
  • the phenomenon of a propagating wave (light or sound) being thrown back from a surface
  • a calm, lengthy, intent consideration
  • of or relating to or capable of refraction
  • the trait of being unmanageable
  • a feeling of agitation expressed in continual motion
  • a lack of patience; irritation with anything that causes delay
  • inability to rest or relax or be still
  • the quality of being ceaselessly moving or active
  • the trait of seeming ill at ease
  • feelings of anxiety that make you tense and irritable
  • physical discomfort (as mild sickness or depression)
  • inability to rest or relax or be still
  • embarrassment deriving from the feeling that others are critically aware of you

What is the synonym of izteraab?

Synonym of word izteraab are پریشانی, خلل, اضطراب, افراتفری, کھلبلی, آشوب, گڑ بڑ, فساد, ہنگامہ, ہرج

What are the idioms related to izteraab?

Here are the idioms that are related to the word izteraab.

  • Impatience never gets prefermant
  • Live today forgetting the anxieties of the past
  • Nothing in the affairs of men is worthy of great anxiety
  • Do not be in a hurry to tie what you cannot untie
  • Dress slowly when you are in a hurry