Jiger - جگر meanings in English

Jiger - جگر meanings in English are liver, livering, jugger, jager, liveries, hepatics, hepatical, alluvions, hepatic, geiger, soul, mind, heart Jiger - جگر in English. More meanings of jiger - جگر, it's definitions, example sentences, related words, idioms and quotations.

liver livering jugger jager liveries hepatics hepatical alluvions hepatic geiger soul mind heart liver

Install chrome extension

Jiger - جگر Definitions

Please find 34 English and definitions related to the word Jiger - جگر.

  • (noun) : large and complicated reddish-brown glandular organ located in the upper right portion of the abdominal cavity; secretes bile and functions in metabolism of protein and carbohydrate and fat; synthesizes substances involved in the clotting of the blood; synthesizes vitamin A; detoxifies poisonous substances and breaks down worn-out erythrocytes
  • (noun) : liver of an animal used as meat
  • (noun) : someone who lives in a place
  • (noun) : a person who has a special life style
  • (adjective satellite) : having a reddish-brown color
  • is delicious when cooked with hot spices. It is commonly made in a curry or fried with various spices.
  • (noun) : your intention; what you intend to do
  • (noun) : an opinion formed by judging something
  • (verb) : pay close attention to; give heed to
  • (noun) : knowledge and intellectual ability
  • (noun) : attention
  • (noun) : recall or remembrance
  • (noun) : an important intellectual
  • (verb) : keep in mind
  • (verb) : be concerned with or about something or somebody
  • (verb) : be offended or bothered by; take offense with, be bothered by
  • (verb) : be on one's guard; be cautious or wary about; be alert to
  • (noun) : that which is responsible for one's thoughts, feelings, and conscious brain functions; the seat of the faculty of reason
  • (noun) : German physicist who developed the Geiger counter (1882-1945)
  • (noun) : a positive feeling of liking
  • (noun) : an area that is approximately central within some larger region
  • (noun) : the courage to carry on
  • (noun) : an inclination or tendency of a certain kind
  • (noun) : the locus of feelings and intuitions
  • (noun) : a playing card in the major suit that has one or more red hearts on it
  • (noun) : a firm rather dry variety meat (usually beef or veal)
  • (noun) : the hollow muscular organ located behind the sternum and between the lungs; its rhythmic contractions move the blood through the body
  • (noun) : a plane figure with rounded sides curving inward at the top and intersecting at the bottom; conventionally used on playing cards and valentines
  • (noun) : any of numerous small green nonvascular plants of the class Hepaticopsida growing in wet places and resembling green seaweeds or leafy mosses
  • (adjective) : pertaining to or affecting the liver
  • (noun) : the human embodiment of something
  • (noun) : a secular form of gospel that was a major Black musical genre in the 1960s and 1970s
  • (noun) : deep feeling or emotion
  • (noun) : the immaterial part of a person; the actuating cause of an individual life

More words from English related to Jiger - جگر

View an extensive list of words below that are related to the meanings of the word Jiger - جگر meanings in English in English.

accedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateaccountdeferheedrespectside withenvisionfancyguessimaginesupposethinkcareconsiderfigureobservepremeditate ...

Idioms related to the meaning of Jiger - جگر

Good for the liver may be bad for the spleenایک ہی دوا سب بیماریوں کے لئے نافع نہیں
Heart to heartبے تکلف اور آزاد
A holy habit cleanseth not a foul soulپاک جامہ پہن لینے سے ناپاک روح صاف نہیں ہو جاتی
A little man doth often harbour a great soulبعض اوقات چھوٹے دِلوں میں بھی بڑے کام کرنے کی قوت ہوتی ہے
A wound does not pierce the soulتِلوار کا گھاوٴ بھر جاتا ہے زُبان کا گھاوٴ نہیں بھرتا
An little silly soul easily can pick a holeنُکتہ چینی بہت آسان ہے
Beauty pleases the eyes but only sweetness of disposition charms the soulشعر ، سیرت کے ہم غُلام ہیں صورت ہوئی تو کیا سُرخ و سفید مٹی کی مورت ہوئی تو کیا
Beauty pleases the eyes but only sweetness of disposition charms the soulشعر سیرت کے ہم غُلام ہیں صورت ہوئی تو کیاسُرخ و سفید مٹی کی مورت ہوئی تو کیا
Body clothes soulجسم روح کا لباس ہے
Brevity is the soul of witاختصار ظرافت کی جان ہے
Confidence like the soul never returns thither whence it has departedساکھ جہاں گئی گئی
Conscience is the voice of the soul the passions are the voice of the bodyضمیر روح کی آواز ہے اور جذبات جِسم کی
Expedition is the soul of businessپھرتی کاروبار کی جان ہے
Forced prayers are no good for the soulجھوٹے دل کی دعا کس کام کی
God trusts every one with the care of his own soulاللہ ہر شخص کو اس کے ضمیر کا ذِمہ دار بناتا ہے
Keep body and soul togetherزندگی قائم رکھنا
Keep body and soul togetherجسم و جاں کا رشتہ برقرار رکھنا
Keep body and soul togetherمشکل حالات میں زند ہ رہنے کے لیے جدوجہد کرنا
Keep body and soul togetherجسم و جاں کا رشتہ بر قرارر کھنا مشکل حالات میں زندہ رہنے کے لیے جدوجہد کرنا
Open confession is good for the soulاپنے قصور کا کھلم کھلا اعتراف کر لینا ضمیر کے لیے اچھا
View More ...

What are the meanings of Jiger - جگر in English?

Meanings of the word Jiger - جگر in English are liver, mind, geiger, heart, hepatic, soul, alluvions, hepatical, hepatics, liveries, jager, jugger and livering. To understand how would you translate the word Jiger - جگر in English, you can take help from words closely related to Jiger - جگر or it’s English translations. Some of these words can also be considered Jiger - جگر synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Jiger - جگر. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Jiger - جگر in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Jiger - جگر in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Jiger - جگر with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by jiger?

Meanings of jiger are liver, mind, geiger, heart, hepatic, soul, alluvions, hepatical, hepatics, liveries, jager, jugger and livering

Whats the definition of jiger?

Definition of the jiger are

  • large and complicated reddish-brown glandular organ located in the upper right portion of the abdominal cavity; secretes bile and functions in metabolism of protein and carbohydrate and fat; synthesizes substances involved in the clotting of the blood; synthesizes vitamin A; detoxifies poisonous substances and breaks down worn-out erythrocytes
  • liver of an animal used as meat
  • someone who lives in a place
  • a person who has a special life style
  • having a reddish-brown color
  • is delicious when cooked with hot spices. It is commonly made in a curry or fried with various spices.
  • your intention; what you intend to do
  • an opinion formed by judging something
  • pay close attention to; give heed to
  • knowledge and intellectual ability
  • attention
  • recall or remembrance
  • an important intellectual
  • keep in mind
  • be concerned with or about something or somebody
  • be offended or bothered by; take offense with, be bothered by
  • be on one's guard; be cautious or wary about; be alert to
  • that which is responsible for one's thoughts, feelings, and conscious brain functions; the seat of the faculty of reason
  • German physicist who developed the Geiger counter (1882-1945)
  • a positive feeling of liking
  • an area that is approximately central within some larger region
  • the courage to carry on
  • an inclination or tendency of a certain kind
  • the locus of feelings and intuitions
  • a playing card in the major suit that has one or more red hearts on it
  • a firm rather dry variety meat (usually beef or veal)
  • the hollow muscular organ located behind the sternum and between the lungs; its rhythmic contractions move the blood through the body
  • a plane figure with rounded sides curving inward at the top and intersecting at the bottom; conventionally used on playing cards and valentines
  • any of numerous small green nonvascular plants of the class Hepaticopsida growing in wet places and resembling green seaweeds or leafy mosses
  • pertaining to or affecting the liver
  • the human embodiment of something
  • a secular form of gospel that was a major Black musical genre in the 1960s and 1970s
  • deep feeling or emotion
  • the immaterial part of a person; the actuating cause of an individual life

What is the synonym of jiger?

Synonym of word jiger are جگر, کلیجا, کبد, کلیجی, ماننا, لحاظ کرنا, خیال کرنا, میلان, دماغ, غور کرنا

What are the idioms related to jiger?

Here are the idioms that are related to the word jiger.

  • Good for the liver may be bad for the spleen
  • Heart to heart
  • A holy habit cleanseth not a foul soul
  • A little man doth often harbour a great soul
  • A wound does not pierce the soul

Paragraph Transliteration