Jul deyna - جل دینا meanings in English
Jul deyna - جل دینا meanings in English are hocus, spoof, beguile, cheat, deceive, fudge, hoodwink, trick Jul deyna - جل دینا in English. More meanings of jul deyna - جل دینا, it's definitions, example sentences, related words, idioms and quotations.
Jul deyna - جل دینا Definitions
Please find 21 English and definitions related to the word Jul deyna - جل دینا.
- (noun) : a deception for profit to yourself
- (noun) : the act of swindling by some fraudulent scheme
- (noun) : someone who leads you to believe something that is not true
- (noun) : weedy annual native to Europe but widely distributed as a weed especially in wheat
- (noun) : weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- (verb) : deprive somebody of something by deceit
- (verb) : engage in deceitful behavior; practice trickery or fraud
- (verb) : be sexually unfaithful to one's partner in marriage
- (verb) : defeat someone through trickery or deceit
- (noun) : a composition that imitates or misrepresents somebody's style, usually in a humorous way
- (verb) : cause someone to believe an untruth
- (verb) : be false to; be dishonest with
- (noun) : soft creamy candy
- (verb) : tamper, with the purpose of deception
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
More words related to the meanings of Jul deyna - جل دینا
More words from English related to Jul deyna - جل دینا
View an extensive list of words below that are related to the meanings of the word Jul deyna - جل دینا meanings in English in English.
abducemisdirectmisguidemisleadbeguilebluffdepravewronglead astrayleading astraymislikingmisplayingartfulnesschouscross biteguilehoaxhypocrisyillusionimposturejugglelegerdemainruseshamcheatingdeceitdeceivingdeceptiondouble dealingfallowfraudgriftjuggleryliemountebankerynetspooftricktrickerywilewilfulnessdelusivewilefuldecededecencedesudationcheatcircumventionfeint husk ... bandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositionjapeblackmailbullyinghighhandednessbullarycircumlocutiondifferenceturningwindingdiddlehoodwinkinghypelurchmisgiveoutwitswindlebafflebamboozlebefoolbilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangedisbelieverdishonestfaithlessfraudulentimmoralshonkyjacklegnefariousnullifidianperfidiousunconscionableunfairunfaithfulunprincipledwide boyrascalmalpractitionerunreliabledissembling guilefulillusiveimpostorknavishlyingriggershiftybamboozlercunningdeceitfuldeceiverdodgerdodgygnosticillusoryimposterinsidiousinsinceremisleadermountebankspurioustrickstertrickywilfulfreebeediversion circlecoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawnenchafefashfingergalljokeribtampervexwantonannoydisturbfillipirritatekidmolestnettletauntteasetickletamp downtease aparttee offteeterchafferingtaffetytamesttampingtattersteadteadeteamerteaselingteasellingteasesteeteringteindingtetteringtewarttotherscastigatingirroratemuriculatetabefactionfablefeignframemalleatemanufacturefabricatefalsifyforgeinventtrumpvampfalsityshammershifterfelonmendaciousdeceiversdeludershumbuginsincerityquizgrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingintrigueloveplotrelationrelevancyloggepretextdevicedisguise excusequibbletrepangullhocusvictimizewheedlemake believevictimisepalaverbrewjugglingsleightwelshmakemakingmixturenaturesynthesiscompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningopportunitymurderambushartificeaffectationairscoquetryflirtingpretenceswaggermisappropriatebeguilementdamagelosschacmabotchbunglerobdishonourcoaxinveigleseduceflatterclevernessdabmopseductionmagicmiracleevasion frictiongashhacksophistry
Idioms related to the meaning of Jul deyna - جل دینا
What are the meanings of Jul deyna - جل دینا in English?
Meanings of the word Jul deyna - جل دینا in English are cheat, hocus, spoof, beguile, deceive, fudge, hoodwink and trick. To understand how would you translate the word Jul deyna - جل دینا in English, you can take help from words closely related to Jul deyna - جل دینا or it’s English translations. Some of these words can also be considered Jul deyna - جل دینا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Jul deyna - جل دینا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Jul deyna - جل دینا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Jul deyna - جل دینا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Jul deyna - جل دینا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by jul deyna?
Meanings of jul deyna are cheat, hocus, spoof, beguile, deceive, fudge, hoodwink and trick
Whats the definition of jul deyna?
Definition of the jul deyna are
- a deception for profit to yourself
- the act of swindling by some fraudulent scheme
- someone who leads you to believe something that is not true
- weedy annual native to Europe but widely distributed as a weed especially in wheat
- weedy annual grass often occurs in grainfields and other cultivated land; seeds sometimes considered poisonous
- deprive somebody of something by deceit
- engage in deceitful behavior; practice trickery or fraud
- be sexually unfaithful to one's partner in marriage
- defeat someone through trickery or deceit
- a composition that imitates or misrepresents somebody's style, usually in a humorous way
- cause someone to believe an untruth
- be false to; be dishonest with
- soft creamy candy
- tamper, with the purpose of deception
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
What is the synonym of jul deyna?
Synonym of word jul deyna are چھل, دم, جھانسا, دھوکا, جُل, بُتّا, دھونس, دھوکا دینا, بے ایمان, بد دیانت
What are the idioms related to jul deyna?
Here are the idioms that are related to the word jul deyna.
- Hocus pocus
- Cheat me in the price but not in the goods
- It is a double pleasure to cheat the cheater
- One trick needs a great many more to make it good
- Quick trick