Lapakna - لپکنا meanings in English
Lapakna - لپکنا meanings in English are grab, launch, make haste, pulsate, run, snap, snatch, spring, throb, hent, flash, scoot, attack, beat, bound, catch a ball, claw, clutch, dart, lipping Lapakna - لپکنا in English. More meanings of lapakna - لپکنا, it's definitions, example sentences, related words, idioms and quotations.
grab launch make haste pulsate run snap snatch spring throb hent flash scoot attack beat bound catch a ball claw clutch dart lipping
Lapakna - لپکنا Definitions
Please find 219 English and 3 Urdu definitions related to the word Lapakna - لپکنا.
- (noun) : sharp curved horny process on the toe of a bird or some mammals or reptiles
- (noun) : a mechanical device that is curved or bent to suspend or hold or pull something
- (verb) : attack as if with claws
- (verb) : clutch as if in panic
- (verb) : scratch, scrape, pull, or dig with claws or nails
- (verb) : move as if by clawing, seizing, or digging
- (noun) : a grasping structure on the limb of a crustacean or other arthropods
- (noun) : a bird's foot
- (noun) : a collection of things or persons to be handled together
- (noun) : a coupling that connects or disconnects driving and driven parts of a driving mechanism
- (noun) : a number of birds hatched at the same time
- (noun) : a tense critical situation
- (noun) : the act of grasping
- (verb) : affect
- (verb) : take hold of; grab
- (verb) : hold firmly, usually with one's hands
- (noun) : a pedal or lever that engages or disengages a rotating shaft and a driving mechanism
- (noun) : a woman's strapless purse that is carried in the hand
- (noun) : a tapered tuck made in dressmaking
- (noun) : a small narrow pointed missile that is thrown or shot
- (verb) : run or move very quickly or hastily
- (verb) : move with sudden speed
- (verb) : run or move very quickly or hastily
- (noun) : a lamp for providing momentary light to take a photograph
- (noun) : a bright patch of color used for decoration or identification
- (noun) : a momentary brightness
- (noun) : a sudden brilliant understanding
- (noun) : a short vivid experience
- (noun) : a sudden intense burst of radiant energy
- (noun) : a burst of light used to communicate or illuminate
- (noun) : a short news announcement concerning some on-going news story
- (verb) : expose or show briefly
- (verb) : gleam or glow intermittently
- (verb) : appear briefly
- (verb) : emit a brief burst of light
- (verb) : make known or cause to appear with great speed
- (verb) : protect by covering with a thin sheet of metal
- (noun) : a very short time (as the time it takes the eye to blink or the heart to beat)
- (noun) : a gaudy outward display
- (noun) : a mechanical device for gripping an object
- (verb) : make a grasping or snatching motion with the hand
- (verb) : obtain illegally or unscrupulously
- (verb) : capture the attention or imagination of
- (verb) : take or grasp suddenly
- (verb) : get hold of or seize quickly and easily
- (verb) : be diffused
- (verb) : flee; take to one's heels; cut and run
- (verb) : include as the content; broadcast or publicize
- (noun) : a race between candidates for elective office
- (verb) : run, stand, or compete for an office or a position
- (verb) : keep company
- (verb) : move along, of liquids
- (verb) : continue to exist
- (verb) : perform as expected when applied
- (verb) : pursue for food or sport (as of wild animals)
- (verb) : cause something to pass or lead somewhere
- (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (verb) : have a tendency or disposition to do or be something; be inclined
- (verb) : progress by being changed
- (verb) : direct or control; projects, businesses, etc.
- (verb) : compete in a race
- (noun) : a row of unravelled stitches
- (verb) : change or be different within limits
- (noun) : a small stream
- (noun) : a score in baseball made by a runner touching all four bases safely
- (noun) : the act of running; traveling on foot at a fast pace
- (noun) : a regular trip
- (noun) : a short trip
- (noun) : an unbroken chronological sequence
- (noun) : the production achieved during a continuous period of operation (of a machine or factory etc.)
- (noun) : unrestricted freedom to use
- (noun) : the continuous period of time during which something (a machine or a factory) operates or continues in operation
- (noun) : an unbroken series of events
- (noun) : the act of testing something
- (noun) : a race run on foot
- (verb) : cause an animal to move fast
- (verb) : move about freely and without restraint, or act as if running around in an uncontrolled way
- (verb) : deal in illegally, such as arms or liquor
- (verb) : set animals loose to graze
- (verb) : make without a miss
- (verb) : carry out a process or program, as on a computer or a machine
- (verb) : occur persistently
- (verb) : extend or continue for a certain period of time
- (verb) : be affected by; be subjected to
- (verb) : have a particular form
- (verb) : become undone
- (verb) : cause to perform
- (verb) : change from one state to another
- (verb) : be operating, running or functioning
- (verb) : carry out
- (verb) : cover by running; run a certain distance
- (verb) : move fast by using one's feet, with one foot off the ground at any given time
- (verb) : travel rapidly, by any (unspecified) means
- (verb) : run with the ball; in such sports as football
- (verb) : sail before the wind
- (verb) : come unraveled or undone as if by snagging
- (verb) : reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (noun) : (American football) a play in which a player attempts to carry the ball through or past the opposing team
- (verb) : cause to emit recorded audio or video
- (verb) : pass over, across, or through
- (verb) : run or move very quickly or hastily
- (noun) : any undertaking that is easy to do
- (verb) : cause to make a snapping sound
- (verb) : move or strike with a noise
- (noun) : a sudden sharp noise
- (verb) : make a sharp sound
- (verb) : break suddenly and abruptly, as under tension
- (verb) : record on photographic film
- (noun) : an informal photograph; usually made with a small hand-held camera
- (noun) : the act of snapping the fingers; movement of a finger from the tip to the base of the thumb on the same hand
- (noun) : a fastener used on clothing; fastens with a snapping sound
- (noun) : a sudden breaking
- (noun) : the noise produced by the rapid movement of a finger from the tip to the base of the thumb on the same hand
- (noun) : a spell of cold weather
- (noun) : (American football) putting the ball in play by passing it (between the legs) to a back
- (noun) : the tendency of a body to return to its original shape after it has been stretched or compressed
- (noun) : tender green beans without strings that easily snap into sections
- (noun) : a crisp round cookie flavored with ginger
- (verb) : move with a snapping sound
- (verb) : utter in an angry, sharp, or abrupt tone
- (verb) : put in play with a snap
- (verb) : to grasp hastily or eagerly
- (verb) : lose control of one's emotions
- (verb) : close with a snapping motion
- (verb) : bring the jaws together
- (verb) : take away to an undisclosed location against their will and usually in order to extract a ransom
- (noun) : a small fragment
- (noun) : (law) the unlawful act of capturing and carrying away a person against their will and holding them in false imprisonment
- (verb) : to grasp hastily or eagerly
- (noun) : a weightlift in which the barbell is lifted overhead in one rapid motion
- (verb) : to make grasping motions
- (noun) : the elasticity of something that can be stretched and returns to its original length
- (verb) : move forward by leaps and bounds
- (verb) : spring back; spring away from an impact
- (noun) : a metal elastic device that returns to its shape or position when pushed or pulled or pressed
- (noun) : a point at which water issues forth
- (noun) : the season of growth
- (verb) : produce or disclose suddenly or unexpectedly
- (verb) : develop suddenly
- (noun) : a light, self-propelled movement upwards or forwards
- (noun) : ideas or actions intended to deal with a problem or situation
- (noun) : intense adverse criticism
- (verb) : attack in speech or writing
- (verb) : take the initiative and go on the offensive
- (verb) : attack someone physically or emotionally
- (noun) : a decisive manner of beginning a musical tone or phrase
- (noun) : an offensive move in a sport or game
- (noun) : the act of attacking
- (noun) : (military) an offensive against an enemy (using weapons)
- (noun) : strong criticism
- (noun) : the onset of a corrosive or destructive process (as by a chemical agent)
- (noun) : a sudden occurrence of an uncontrollable condition
- (verb) : begin to injure
- (verb) : launch an attack or assault on; begin hostilities or start warfare with
- (verb) : set to work upon; turn one's energies vigorously to a task
- (verb) : be a mystery or bewildering to
- (verb) : avoid paying
- (verb) : make a rhythmic sound
- (verb) : move with a flapping motion
- (verb) : move with a thrashing motion
- (noun) : the basic rhythmic unit in a piece of music
- (noun) : a regular route for a sentry or policeman
- (verb) : stir vigorously
- (verb) : wear out completely
- (adjective satellite) : very tired
- (noun) : a stroke or blow
- (noun) : a regular rate of repetition
- (noun) : the sound of stroke or blow
- (noun) : the rhythmic contraction and expansion of the arteries with each beat of the heart
- (verb) : hit repeatedly
- (verb) : strike (water or bushes) repeatedly to rouse animals for hunting
- (verb) : shape by beating
- (verb) : produce a rhythm by striking repeatedly
- (verb) : make by pounding or trampling
- (verb) : move with or as if with a regular alternating motion
- (verb) : move rhythmically
- (verb) : sail with much tacking or with difficulty
- (verb) : glare or strike with great intensity
- (verb) : make a sound like a clock or a timer
- (verb) : be superior
- (noun) : the act of beating to windward; sailing as close as possible to the direction from which the wind is blowing
- (noun) : a member of the beat generation; a nonconformist in dress and behavior
- (noun) : a single pulsation of an oscillation produced by adding two waves of different frequencies; has a frequency equal to the difference between the two oscillations
- (verb) : give a beating to; subject to a beating, either as a punishment or as an act of aggression
- (verb) : strike (a part of one's own body) repeatedly, as in great emotion or in accompaniment to music
- (verb) : indicate by beating, as with the fingers or drumsticks
- (noun) : a line determining the limits of an area
- (verb) : move forward by leaps and bounds
- (noun) : the greatest possible degree of something
- (verb) : spring back; spring away from an impact
- (adjective satellite) : bound by contract
- (adjective satellite) : covered or wrapped with a bandage
- (noun) : the line or plane indicating the limit or extent of something
- (adjective) : confined by bonds
- (adjective satellite) : confined in the bowels
- (adjective satellite) : bound by an oath
- (verb) : form the boundary of; be contiguous to
- (noun) : a light, self-propelled movement upwards or forwards
- (verb) : place limits on (extent or amount or access)
- (adjective) : secured with a cover or binding; often used as a combining form
- (adjective satellite) : (usually followed by to') governed by fate
- (adjective) : held with another element, substance or material in chemical or physical union
- (adjective satellite) : headed or intending to head in a certain direction; often used as a combining form as in college-bound students'
- (verb) : set up or found
- (verb) : begin with vigor
- (noun) : the act of propelling with force
- (noun) : a motorboat with an open deck or a half deck
- (verb) : smoothen the surface of
- (verb) : propel with force
- (verb) : get going; give impetus to
- (verb) : launch for the first time; launch on a maiden voyage
- (verb) : move with or as if with a regular alternating motion
- (verb) : produce or modulate (as electromagnetic waves) in the form of short bursts or pulses or cause an apparatus to produce pulses
- (verb) : expand and contract rhythmically; beat rhythmically
- (verb) : tremble convulsively, as from fear or excitement
- (noun) : an instance of rapid strong pulsation (of the heart)
- (noun) : a deep pulsating type of pain
- (verb) : pulsate or pound with abnormal force
- (verb) : expand and contract rhythmically; beat rhythmically
- دھات کی پتلی سی تہ جو کِسی سانچے کے دو حِصّوں کے درمیان باقی رہ جاتی ہے
- اچانک اور شدید سی آواز نِکالنا
- اچانک سے ہاتھ بڑھا کر پکڑ لینا
More words related to the meanings of Lapakna - لپکنا
More words from English related to Lapakna - لپکنا
View an extensive list of words below that are related to the meanings of the word Lapakna - لپکنا meanings in English in English.
actmovemoseysnapmovingnessaggressionraidassaultattackincursioninvasionirruptionoffenceoffensiveonfallonsetonslaughtstrokeassoilinvarianceassailedassailmentassaultsassoiledassoilmentassoilsattackedincursionsinvadesinvalidedassastioninvillagedagitateblewdrive hollohoopimpelmanagemarchrantsnivelwagwalkbellowinitiateoperaterunstirweep ... yammerimplateemballapprehendcapturecatchentrammel grabgraspgripholdnailobtainsniggletakeclutchcopdetectdiscovergripehaulhitchpreventseizetweezeclutchinggrabbinggrabblingwinchingappropriateoccupyacquirebeleaguerencroachget hold ofimpingeobsessoverpoweroverrunpossesssmugtake overtake possessionusurpoccupyingoccupatesequestratingtaking possessionaquositydartdrift moisturestreamlinecurrentseelingsaalesillscelcelsseelsseilseilsseinesseirsseleselsarcarchbowspringcomminationbowwowsbangchastisedashdrub flapknocklynchmasterovercomeputtbeathitjugulatekillknucklesmitestrapstrikezaphittingstrokingbashingbatinghitheskippingsloshessmitsmitingsmittingsmoteto beatmalleatemaulribroastruetaborbashbatterbruiseclobbercontusecurrydefeatdingpoundpunishtickletrouncewallopwhackwhompwhopyerkbeatingblazonemblazeenlightenflashfurbishglossillumebrightenexcitegleamirradiatepolishscourshinevarnishbrislingglossinaglowerspurge nettleaglimmerblimbingblimbingsblimyclematisesfandangleflashierflickingfunnellinggleamiestglissadingglozingpryingsrepiningsheeningtweakingtweezingglutinatingimbureingblurteruptblast offblastoffburst outglanceglareglistenglitterlightenscfintillateshimmerfulgurateglintglowradiateresplendscintillatetwinklebrindlebristle upglintingglisteningglowwormshine atshine upshingleshinglingspickspitterchimingfanklespindlingglabreateglunchshindlebrinkmarginshaftarrowpassedarrowsswambraycrushthrashthreshcaitiffragamuffinrascalribaldcadcontemptiblelowmiscreantscampscoundrelvilecussedearth bredmobbishpiggishabjectbasecaddishdepravedfeloniousfootyignoblemaliciousmeannastyniggardpusillanimoussnotuglyunderbredvulgarcastdiscard dumpejaculationejectflinghurlhurtlejerklaunchlobmewrejectscatterslamspillsquanderthrowthrowawaytiptosswaivewarpwastedrowse offhurlinginfoldingpeltslingslingingthrash outpulpingsnaringsnarlingstrowingthrawthreapthreapingtrowingDisposed Offcaperscaperingflouncefriskhopleapskipspurtjouncejumpjump offleapingblippinghuppingleaptleppingleveringlispingskeppingcurvetfrolicboundvaultjumpinesshumpingchapcleavecrackdivaricaterivetearbreakbreak upburstexploderipbursiformbursterburstingclapper clawcropnipavulseclawfleecehentpluckraunchscratchsnatchtweaktwitchembrittledtalonchelapawclunchclunchesclutchedfivegriffmanusquinaryclawbackclawedclawfootclawingtoeencroachmentkeepingmanubriummasteryoccupancyoccupationtenurehafthandlehilthingeholdingknuckle jointpossessingpossessionpowerseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivalphalanxquirebrigadecohortcontingentdoorknobfleetknophandsturnconfute foiloutfaceconfoundcounteractdiscomfitfloor lickoutclassoutdooutgunwhupcostivefasttiedcoursegallopracescootcommittedstraightadheringfetterfettered following limitedsubjugatedsubordinatebindablebindweedbondablebound upboundenbongedboundingcubitcubitsdaddleforthcomingarmauthoritycommandhandinterferencepatronageprotectionreachslapsupporthandsfistfistskissmaniplehandfulfeistfistmelefisticfisticalfistyfistinutmissilepikelancewellhalberdjavelinspearspearsspearwortmacevergeflowflushglidejetwaftdribblerunnyflowsfleerun awaybreak awaybreakawayspear upfleighgrovellermirymiserlydogfalleniniquitousinsultablelewdmenialscumsnideunderfootverminouswormywretchedhumifieddegreaseddegummeddemisslyhumilianthummabledisglorifiedeffulgenceglossinesslightlucencysunshinebrilliancyflashinglightningluminescencescintillasheenbrashnessbrillbrininessbristlinessfadflashinessgimpinessgleaminggloamglomgloweringgluinessglumnessluridnesslustermagnanimousnessshinglesshininessspandrelsparklesparkleberryvoluminousnessaurasblitzesbrassinessbriningbrinksbriskensflashesflasksfleshesgashlinessgigglesgleamedgleamiergleamingsgleamsglimmeredglimsglintsglisksglistensglitzinessgloamingsgloireglomeratedglomsgloriesglowlampglowslustersshashesspanglesspangssparkledsparklessparkletspecklingsplorethimblingwhimsbrilliantnessbrinishnessbrushinessglabrityglaseglebositygliresglomeglomerationgrintshiningnessbrilliancelustreengagemobbingsicassailchargego atinvadestormattackinggang upassailingassiegeassiegingencashinginvilefaregivejourneymakecomegopaceproceedtreadlikewalkstokingtreadingstreadlingfierceflameblazeflareflameletflemeglimpseglimmerdegeneratehucksterreprobatelowishfribble humbleleastminutepaltrycoarseimmaterialinconsequentialinferiorlittleminornothingpicayuneregardlessslavishtrivialunderunderdogunimportantflitfountainwatercoursestreamtankbeckeyeglassspectacleswellheadspringleteyeteethgallantgarishgaudygayostentatiouspretentiousfigureheadflamboyantgrandgrandiosekitschloudmodalshowyexhibitionistexhibitionisticexhibitiveobjectiontakingvalencyclampcriticismgrapplelockseizinggripesgripinggrippingcapturinggrabsgracinggraipgraipsgrapinggraspergraspsgrikegripedgrippergripsgripplenesshoundhuddlehurryhastenhiemake hastemake timehurryingrushingabashinghasteninghastinghurrahinghurraingjollifyingfakefall uponmobblowlikeresemblingstabsmaraudmidstverydirect exacteyepreciserealaineenayennabswoop upfingernailnachesunnailsoustspoilstripdespoilpitapatvibrancypalpitationpulsethrobthrobbingbeatificcoruscationdownbeatpalpatorypalpitantpalteringdownbeatsjerkspalpatespalpatingpalpationspalpitatedpalpitatesthrobbedthrobsraiderinrushrazziaslipslidejump onplungingplungingsplunkingmaterialisedemoticabductdispelimbrueimbuemoilsaturateadherentattachedconnecteddepending oninvolvedrelativeaccumbentcleavableaffiancedaccumbaffiliatingascendancyascentclimbmountingsteepinveighrebukerevileshoutsnubthrustpenetratecudgelblessbludgeonflogmanhandlewhangpalpitatepulsatequoptingletwitterberatingbetidingblabbingblatterationblotingbeautybloomdelightgloryheydayprimebiharspringinessspringtidespringaldspringaldsspringierspringlebaharbendbickerditherdodderoscillatequakequaverquivershakeshivertittertottertremblevibratewamblewapperquaveringrockingrokingbraggartcoxcombfinicalfopfrustrateposeurpriggishpseudorhetoricsanctimoniusswankyvaincrabcommencedexterityswiftnesslipicdispossesswrestsnatch upsashingsnabblingsnaggingsnatchysnathesnootinggoadexploitgatherharryplunderpullsparkgibescofftwitloftbelchingblat outenouncenip offpercussivescrunch upsnip offtoss uptossupunyokeawantingbecalmingblatterblattingenrangefloutinggloutingschleppingspuingstireunhuskunshoutingflutterhankerwritheyearnflurtfountain headsourcewellspringrabi
Idioms related to the meaning of Lapakna - لپکنا
What are the meanings of Lapakna - لپکنا in English?
Meanings of the word Lapakna - لپکنا in English are claw, clutch, dart, flash, grab, run, scoot, snap, snatch, spring, attack, beat, bound, launch, pulsate, throb, hent, lipping, catch a ball and make haste. To understand how would you translate the word Lapakna - لپکنا in English, you can take help from words closely related to Lapakna - لپکنا or it’s English translations. Some of these words can also be considered Lapakna - لپکنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Lapakna - لپکنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Lapakna - لپکنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Lapakna - لپکنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Lapakna - لپکنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by lapakna?
Meanings of lapakna are claw, clutch, dart, flash, grab, run, scoot, snap, snatch, spring, attack, beat, bound, launch, pulsate, throb, hent, lipping, catch a ball and make haste
Whats the definition of lapakna?
Definition of the lapakna are
- sharp curved horny process on the toe of a bird or some mammals or reptiles
- a mechanical device that is curved or bent to suspend or hold or pull something
- attack as if with claws
- clutch as if in panic
- scratch, scrape, pull, or dig with claws or nails
- move as if by clawing, seizing, or digging
- a grasping structure on the limb of a crustacean or other arthropods
- a bird's foot
- a collection of things or persons to be handled together
- a coupling that connects or disconnects driving and driven parts of a driving mechanism
- a number of birds hatched at the same time
- a tense critical situation
- the act of grasping
- affect
- take hold of; grab
- hold firmly, usually with one's hands
- a pedal or lever that engages or disengages a rotating shaft and a driving mechanism
- a woman's strapless purse that is carried in the hand
- a tapered tuck made in dressmaking
- a small narrow pointed missile that is thrown or shot
- run or move very quickly or hastily
- move with sudden speed
- run or move very quickly or hastily
- a lamp for providing momentary light to take a photograph
- a bright patch of color used for decoration or identification
- a momentary brightness
- a sudden brilliant understanding
- a short vivid experience
- a sudden intense burst of radiant energy
- a burst of light used to communicate or illuminate
- a short news announcement concerning some on-going news story
- expose or show briefly
- gleam or glow intermittently
- appear briefly
- emit a brief burst of light
- make known or cause to appear with great speed
- protect by covering with a thin sheet of metal
- a very short time (as the time it takes the eye to blink or the heart to beat)
- a gaudy outward display
- a mechanical device for gripping an object
- make a grasping or snatching motion with the hand
- obtain illegally or unscrupulously
- capture the attention or imagination of
- take or grasp suddenly
- get hold of or seize quickly and easily
- be diffused
- flee; take to one's heels; cut and run
- include as the content; broadcast or publicize
- a race between candidates for elective office
- run, stand, or compete for an office or a position
- keep company
- move along, of liquids
- continue to exist
- perform as expected when applied
- pursue for food or sport (as of wild animals)
- cause something to pass or lead somewhere
- stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- have a tendency or disposition to do or be something; be inclined
- progress by being changed
- direct or control; projects, businesses, etc.
- compete in a race
- a row of unravelled stitches
- change or be different within limits
- a small stream
- a score in baseball made by a runner touching all four bases safely
- the act of running; traveling on foot at a fast pace
- a regular trip
- a short trip
- an unbroken chronological sequence
- the production achieved during a continuous period of operation (of a machine or factory etc.)
- unrestricted freedom to use
- the continuous period of time during which something (a machine or a factory) operates or continues in operation
- an unbroken series of events
- the act of testing something
- a race run on foot
- cause an animal to move fast
- move about freely and without restraint, or act as if running around in an uncontrolled way
- deal in illegally, such as arms or liquor
- set animals loose to graze
- make without a miss
- carry out a process or program, as on a computer or a machine
- occur persistently
- extend or continue for a certain period of time
- be affected by; be subjected to
- have a particular form
- become undone
- cause to perform
- change from one state to another
- be operating, running or functioning
- carry out
- cover by running; run a certain distance
- move fast by using one's feet, with one foot off the ground at any given time
- travel rapidly, by any (unspecified) means
- run with the ball; in such sports as football
- sail before the wind
- come unraveled or undone as if by snagging
- reduce or cause to be reduced from a solid to a liquid state, usually by heating
- (American football) a play in which a player attempts to carry the ball through or past the opposing team
- cause to emit recorded audio or video
- pass over, across, or through
- run or move very quickly or hastily
- any undertaking that is easy to do
- cause to make a snapping sound
- move or strike with a noise
- a sudden sharp noise
- make a sharp sound
- break suddenly and abruptly, as under tension
- record on photographic film
- an informal photograph; usually made with a small hand-held camera
- the act of snapping the fingers; movement of a finger from the tip to the base of the thumb on the same hand
- a fastener used on clothing; fastens with a snapping sound
- a sudden breaking
- the noise produced by the rapid movement of a finger from the tip to the base of the thumb on the same hand
- a spell of cold weather
- (American football) putting the ball in play by passing it (between the legs) to a back
- the tendency of a body to return to its original shape after it has been stretched or compressed
- tender green beans without strings that easily snap into sections
- a crisp round cookie flavored with ginger
- move with a snapping sound
- utter in an angry, sharp, or abrupt tone
- put in play with a snap
- to grasp hastily or eagerly
- lose control of one's emotions
- close with a snapping motion
- bring the jaws together
- take away to an undisclosed location against their will and usually in order to extract a ransom
- a small fragment
- (law) the unlawful act of capturing and carrying away a person against their will and holding them in false imprisonment
- to grasp hastily or eagerly
- a weightlift in which the barbell is lifted overhead in one rapid motion
- to make grasping motions
- the elasticity of something that can be stretched and returns to its original length
- move forward by leaps and bounds
- spring back; spring away from an impact
- a metal elastic device that returns to its shape or position when pushed or pulled or pressed
- a point at which water issues forth
- the season of growth
- produce or disclose suddenly or unexpectedly
- develop suddenly
- a light, self-propelled movement upwards or forwards
- ideas or actions intended to deal with a problem or situation
- intense adverse criticism
- attack in speech or writing
- take the initiative and go on the offensive
- attack someone physically or emotionally
- a decisive manner of beginning a musical tone or phrase
- an offensive move in a sport or game
- the act of attacking
- (military) an offensive against an enemy (using weapons)
- strong criticism
- the onset of a corrosive or destructive process (as by a chemical agent)
- a sudden occurrence of an uncontrollable condition
- begin to injure
- launch an attack or assault on; begin hostilities or start warfare with
- set to work upon; turn one's energies vigorously to a task
- be a mystery or bewildering to
- avoid paying
- make a rhythmic sound
- move with a flapping motion
- move with a thrashing motion
- the basic rhythmic unit in a piece of music
- a regular route for a sentry or policeman
- stir vigorously
- wear out completely
- very tired
- a stroke or blow
- a regular rate of repetition
- the sound of stroke or blow
- the rhythmic contraction and expansion of the arteries with each beat of the heart
- hit repeatedly
- strike (water or bushes) repeatedly to rouse animals for hunting
- shape by beating
- produce a rhythm by striking repeatedly
- make by pounding or trampling
- move with or as if with a regular alternating motion
- move rhythmically
- sail with much tacking or with difficulty
- glare or strike with great intensity
- make a sound like a clock or a timer
- be superior
- the act of beating to windward; sailing as close as possible to the direction from which the wind is blowing
- a member of the beat generation; a nonconformist in dress and behavior
- a single pulsation of an oscillation produced by adding two waves of different frequencies; has a frequency equal to the difference between the two oscillations
- give a beating to; subject to a beating, either as a punishment or as an act of aggression
- strike (a part of one's own body) repeatedly, as in great emotion or in accompaniment to music
- indicate by beating, as with the fingers or drumsticks
- a line determining the limits of an area
- move forward by leaps and bounds
- the greatest possible degree of something
- spring back; spring away from an impact
- bound by contract
- covered or wrapped with a bandage
- the line or plane indicating the limit or extent of something
- confined by bonds
- confined in the bowels
- bound by an oath
- form the boundary of; be contiguous to
- a light, self-propelled movement upwards or forwards
- place limits on (extent or amount or access)
- secured with a cover or binding; often used as a combining form
- (usually followed by to') governed by fate
- held with another element, substance or material in chemical or physical union
- headed or intending to head in a certain direction; often used as a combining form as in college-bound students'
- set up or found
- begin with vigor
- the act of propelling with force
- a motorboat with an open deck or a half deck
- smoothen the surface of
- propel with force
- get going; give impetus to
- launch for the first time; launch on a maiden voyage
- move with or as if with a regular alternating motion
- produce or modulate (as electromagnetic waves) in the form of short bursts or pulses or cause an apparatus to produce pulses
- expand and contract rhythmically; beat rhythmically
- tremble convulsively, as from fear or excitement
- an instance of rapid strong pulsation (of the heart)
- a deep pulsating type of pain
- pulsate or pound with abnormal force
- expand and contract rhythmically; beat rhythmically
- دھات کی پتلی سی تہ جو کِسی سانچے کے دو حِصّوں کے درمیان باقی رہ جاتی ہے
- اچانک اور شدید سی آواز نِکالنا
- اچانک سے ہاتھ بڑھا کر پکڑ لینا
What is the synonym of lapakna?
Synonym of word lapakna are نوچنا, ناخون, نکھ, نوہ, چنگل, پنجہ, لپکنا, ناخن, چنگل مارنا, پنجہ مارنا
What are the idioms related to lapakna?
Here are the idioms that are related to the word lapakna.
- Claw me and i will claw thee
- If you are bound to forgive an enemy we are not bound to trust him
- A golden dart kills where it pleases
- Flash in the pan
- Have the grab on