Makkar - مکر meanings in English
Makkar - مکر meanings in English are feint, trick, ruse, quiz, machination, insincerity, hoax, guile, sham, imposture, hypocrisy, humbug, wilfulness Makkar - مکر in English. More meanings of makkar - مکر, it's definitions, example sentences, related words, idioms and quotations.
feint trick ruse quiz machination insincerity hoax guile sham imposture hypocrisy humbug wilfulness
Makkar - مکر Definitions
Please find 27 English and definitions related to the word Makkar - مکر.
- (noun) : any distracting or deceptive maneuver (as a mock attack)
- (verb) : deceive by a mock action
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : the quality of being crafty
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (verb) : subject to a playful hoax or joke
- (noun) : pretentious or silly talk or writing
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (verb) : trick or deceive
- (noun) : communication (written or spoken) intended to deceive
- (noun) : insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- (noun) : an expression of agreement that is not supported by real conviction
- (noun) : pretending to be another person
- (noun) : a crafty and involved plot to achieve your (usually sinister) ends
- (noun) : an examination consisting of a few short questions
- (verb) : examine someone's knowledge of something
- (noun) : a deceptive maneuver (especially to avoid capture)
- (noun) : the quality of not being open or truthful; deceitful or hypocritical
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- (noun) : the trait of being prone to disobedience and lack of discipline
More words related to the meanings of Makkar - مکر
More words from English related to Makkar - مکر
View an extensive list of words below that are related to the meanings of the word Makkar - مکر meanings in English in English.
activenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxinessfraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaffectationartificialityconstructionconcoctionconformationdisposition ... edificationequipmentfacefalsification feignfeint fictionfigmentforgingmakemanufacturenatureshamtextureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizespharisaismbunkclaptraphypocrisyinsincerityostentationplausibilityshowappearanceaggregate numberconcurrenceconfluencecontiguitycouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamaccountadditionconnectionconnectednesscontenderinosculationjuncturekinshipknuckleknuckle jointlinklinkagemarrowsolderingsumsuturetotalvampaddlesfoldedjoiningsjointsfolded upimposturejugglerycircumventiondeceptionguilequackerypearlinesspreposterouscreationdeceitinstinctintriguesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitychouscross bitehoaxillusionjugglelegerdemaincheatingdeceivingdouble dealingfallowgriftliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationcheathuskartificialfalseimitativemockspuriousbastardboguscontriveddudfabricatedfactitiousfakepostichepseudorecordedshoddytraditionalunnaturalunorignalduplicitoussimulatedfacinorousimmingledimpingentmimeticalsimulantsimulantssimulatessimulatingsimulatorycentuplicatedduplicativereduplicativebadinagefacetiousnessfungustojestjokejokingludificationquizrailleryderisiondrollerygaghumourjapejocularitylikingmockerypleasantryrelishscofftastewitbanterfunninessgybejest atkiddmock uppoke funprankishbecalmscynicsfunkingfunnierfunsgiddyingjestingsjoukingjustedkiddieskiddingmockadoesmockingsmocksmokesprancingsprankfulprankingprankingsprankspranksomeprankymocklebandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackedge flexionforcing pumptagtailwhiffbrawnbreathcourageendenergyextremitygutheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptailletrapbluffgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusionfallacyimpositiondisloyaltycharcoalbetrayaldouble crosswaterdiversion duplicityhoodwinkingsophistryburnsmakeshiftexpediencypolicystrategianstrategicsstrategiesstrategeticalstrategeticsstrategicircumlocutiondifferenceturningwindingcomedydramamimeryactingdisguise farceimitationimpersonationtravestyconfederacyconspiracymisalliancecabalcollusioncomplotconcordplotconcupiscenceconspectusintriguerintriganteconspersionconspicuityconspissationcontaminationdraff falsehoodfeignedlyhumbuglyingbragcounterfeitinveracitymendacityuntruthfalsenessuntruthfulnessfalsehoodsliegedomliegeslieslieusuntruthsfalnessliascrimeevasion ear ring minoroveraboveloftymadultrauponyoungsterbalasballowdiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazechicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangedissembling fraudulentguilefulhypocriteimpostorknaveknavishslyartfulcunningdeceitfulinsidioustrickywilfulwilyscudscuddingscuddercirclecoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawnfoolingfoolifystupifypretextalibicauseexcusemaskpretencesalvostalepretexfeigned fictitiousapocryphalfabulousforgedkitschphoneyfakeerfakerfakeryfalsiefalsifiablefalsifierfattishforficatephonydummyingfacsimiledfagaceousfaggotedfagotedfakedfakersfakesfakingfalsidicalfalsiesfalsifiedfalsifiersfalsifiesfaucialfordedforfairedforgetiveforjudgedspoofedcounterfeitedcounterfeitlyfalsaryfalsificatorfictiousforwakedfoutyimposturyfaultinessknaverymischiefmischievousnessnaughtinesspranktermagancywaggerywaggishnessbalebamgullimpishnessknavishnessrigvicevillainywickednessblackmailhallucinationforeclosureligationphraseologybondcompositionconstraintlimitationobstructionphraselogyplanqualmrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationfrayexcoriategrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloverelationrelevancyloggedevicequibbletrepanhocusvictimizewheedlemake believevictimisejiltpalaverbrewhollowhollownessvacantnesssimulatemalevolencemalicerancourjoustjugglingsleightinfidelitytreacheryunfaithfulnessdesidiousdesidiousnessknitwattlebecomegathergetpluckpretendselectstitchswankweavebecomingnessknishknitworkknitchesknittleobviationwheyantidotebrachiationbreak evensmash upparbreakparbreakedparbreakssmashesmacrocosmallitrationepigramingenuityquirkskilluniversaluniverseworldfibberymixturesynthesisconfigurationdecoctioninventionmethodmoderecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismwaitinningopportunitymurderambushartificewhim whamsnugnessblastblazeblowflameglowscentwarmthtemporizationcotemporaryabandonmentfaithlessnessingratitudebunkumfablefibfrivolous talkairscoquetryflirtingswaggerbeguilementdamagelosschacmacoaxinveigleseducedabmopseductionmagicmiraclefeigningpretentionmasqueradevisorvizardhypocalcaemiahypocorismhypopityshypocausthypocaustsfrictiongashhackvaingloryshow airsoral examoral examination
Idioms related to the meaning of Makkar - مکر
What are the meanings of Makkar - مکر in English?
Meanings of the word Makkar - مکر in English are feint, guile, hoax, humbug, hypocrisy, imposture, machination, quiz, ruse, sham, insincerity, trick and wilfulness. To understand how would you translate the word Makkar - مکر in English, you can take help from words closely related to Makkar - مکر or it’s English translations. Some of these words can also be considered Makkar - مکر synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Makkar - مکر. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Makkar - مکر in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Makkar - مکر in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Makkar - مکر with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by makkar?
Meanings of makkar are feint, guile, hoax, humbug, hypocrisy, imposture, machination, quiz, ruse, sham, insincerity, trick and wilfulness
Whats the definition of makkar?
Definition of the makkar are
- any distracting or deceptive maneuver (as a mock attack)
- deceive by a mock action
- the use of tricks to deceive someone (usually to extract money from them)
- shrewdness as demonstrated by being skilled in deception
- the quality of being crafty
- something intended to deceive; deliberate trickery intended to gain an advantage
- subject to a playful hoax or joke
- pretentious or silly talk or writing
- something intended to deceive; deliberate trickery intended to gain an advantage
- trick or deceive
- communication (written or spoken) intended to deceive
- insincerity by virtue of pretending to have qualities or beliefs that you do not really have
- an expression of agreement that is not supported by real conviction
- pretending to be another person
- a crafty and involved plot to achieve your (usually sinister) ends
- an examination consisting of a few short questions
- examine someone's knowledge of something
- a deceptive maneuver (especially to avoid capture)
- the quality of not being open or truthful; deceitful or hypocritical
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- the trait of being prone to disobedience and lack of discipline
What is the synonym of makkar?
Synonym of word makkar are بناوٹ, چھل, دھوکا, بُھول, بہانہ, مُغالطَہ, بھلاوا, مغالطہ, مکر, چَھل
What are the idioms related to makkar?
Here are the idioms that are related to the word makkar.
- Hypocrisy pays
- One trick needs a great many more to make it good
- Quick trick
- Serve one a trick
- To play trick