Meyl - میل meanings in English
Meyl - میل meanings in English are afflux, symmetry, tendency, affiliation, amity, coincidence, dirtiness, dross, filth, friendship, harmony, inducement, match, propensity, sullage, unity, maile, mel, mixture, mindedness, agreeableness, agreement, co operation, concurrence, confluence, conformity, consonanace, contiguity, combination, coalitions, dirt, fellowship, grime, junction, league, liaison, mile, miles Meyl - میل in English. More meanings of meyl - میل, it's definitions, example sentences, related words, idioms and quotations.
afflux symmetry tendency affiliation amity coincidence dirtiness dross filth friendship harmony inducement match propensity sullage unity maile mel mixture mindedness agreeableness agreement co operation concurrence confluence conformity consonanace contiguity combination coalitions dirt fellowship grime junction league liaison mile miles
Meyl - میل Definitions
Please find 112 English and 1 Urdu definitions related to the word Meyl - میل.
- (noun) : the act of becoming formally connected or joined
- (noun) : a social or business relationship
- (noun) : a temperamental disposition to be agreeable
- (noun) : pleasantness resulting from agreeable conditions
- (noun) : harmony of people's opinions or actions or characters
- (noun) : compatibility of observations
- (noun) : the thing arranged or agreed to
- (noun) : the statement (oral or written) of an exchange of promises
- (noun) : the verbal act of agreeing
- (noun) : the determination of grammatical inflection on the basis of word relations
- (noun) : the temporal property of two things happening at the same time
- (noun) : agreement of results or opinions
- (noun) : a state of cooperation
- (noun) : acting together, as agents or circumstances or events
- (noun) : a flowing together
- (noun) : a place where things merge or flow together (especially rivers)
- (noun) : a coming together of people
- (noun) : concurrence of opinion
- (noun) : acting according to certain accepted standards
- (noun) : correspondence in form or appearance
- (noun) : orthodoxy in thoughts and belief
- (noun) : hardened conventionality
- (noun) : the attribute of being so near as to be touching
- (noun) : the attribute of being so near as to be touching
- (noun) : the act of combining things to form a new whole
- (noun) : the act of arranging elements into specified groups without regard to order
- (noun) : a collection of things that have been combined; an assemblage of separate parts or qualities
- (noun) : an alliance of people or corporations or countries for a special purpose (formerly to achieve some antisocial end but now for general political or economic purposes)
- (noun) : a group of people (often temporary) having a common purpose
- (noun) : a sequence of numbers or letters that opens a combination lock
- (noun) : a coordinated sequence of chess moves
- (noun) : the temporal property of two things happening at the same time
- (noun) : the quality of occupying the same position or area in space
- (noun) : an event that might have been arranged although it was really accidental
- (noun) : obscene terms for feces
- (noun) : disgraceful gossip about the private lives of other people
- (noun) : the part of the earth's surface consisting of humus and disintegrated rock
- (adjective satellite) : (of roads) not leveled or drained; unsuitable for all year travel
- (noun) : the state of being with someone
- (noun) : an association of people who share common beliefs or activities
- (noun) : money granted (by a university or foundation or other agency) for advanced study or research
- (noun) : any substance considered disgustingly foul or unpleasant
- (noun) : a state characterized by foul or disgusting dirt and refuse
- (noun) : an offensive or indecent word or phrase
- (noun) : the state of being friends (or friendly)
- (verb) : make soiled, filthy, or dirty
- (noun) : the state of being joined together
- (noun) : the shape or manner in which things come together and a connection is made
- (noun) : an act of joining or adjoining things
- (noun) : the place where two or more things come together
- (noun) : something that joins or connects
- (noun) : an association of sports teams that organizes matches for its members
- (noun) : an association of states or organizations or individuals for common action
- (noun) : an obsolete unit of distance of variable length (usually 3 miles)
- (verb) : unite to form a league
- (noun) : a channel for communication between groups
- (noun) : a usually secretive or illicit sexual relationship
- (noun) : a pair of people who live together
- (verb) : bring two objects, ideas, or people together
- (verb) : make equal, uniform, corresponding, or matching
- (noun) : a person who is of equal standing with another in a group
- (verb) : be equal to in quality or ability
- (verb) : make correspond or harmonize
- (noun) : lighter consisting of a thin piece of wood or cardboard tipped with combustible chemical; ignites with friction
- (noun) : an exact duplicate
- (noun) : a burning piece of wood or cardboard
- (noun) : something that resembles or harmonizes with
- (noun) : a formal contest in which two or more persons or teams compete
- (noun) : the score needed to win a match
- (verb) : provide funds complementary to
- (verb) : be equal or harmonize
- (verb) : give or join in marriage
- (verb) : set into opposition or rivalry
- (noun) : a footrace extending one mile
- (noun) : a Swedish unit of length equivalent to 10 km
- (noun) : an ancient Roman unit of length equivalent to 1620 yards
- (noun) : a large distance
- (noun) : a former British unit of length equivalent to 6,080 feet (1,853.184 meters); 800 feet longer than a statute mile
- (noun) : a unit of length used in navigation; exactly 1,852 meters; historically based on the distance spanned by one minute of arc in latitude
- (noun) : a unit of length equal to 1,760 yards or 5,280 feet; exactly 1609.344 meters
- (noun) : a former British unit of length once used in navigation; equivalent to 6,000 feet (1828.8 meters)
- (noun) : any foodstuff made by combining different ingredients
- (noun) : a collection containing a variety of sorts of things
- (noun) : the act of mixing together
- (noun) : an event that combines things in a mixture
- (noun) : (chemistry) a substance consisting of two or more substances mixed together (not in fixed proportions and not with chemical bonding)
- (noun) : balance among the parts of something
- (noun) : (physics) the property of being isotropic; having the same value when measured in different directions
- (noun) : (mathematics) an attribute of a shape or relation; exact reflection of form on opposite sides of a dividing line or plane
- (noun) : an attitude of mind especially one that favors one alternative over others
- (noun) : an inclination to do something
- (noun) : a characteristic likelihood of or natural disposition toward a certain condition or character or effect
- (noun) : a general direction in which something tends to move
- (noun) : a cordial disposition
- (noun) : a state of friendship and cordiality
- (noun) : obscenity in speech or writing
- (noun) : the state of containing dirty impurities
- (noun) : the state of being unsanitary
- (noun) : worthless or dangerous material that should be removed
- (noun) : agreement of opinions
- (noun) : a harmonious state of things in general and of their properties (as of colors and sounds); congruity of parts with one another and with the whole
- (noun) : compatibility in opinion and action
- (noun) : an agreeable sound property
- (noun) : the structure of music with respect to the composition and progression of chords
- (noun) : a positive motivational influence
- (noun) : act of bringing about a desired result
- (noun) : a disposition to behave in a certain way
- (noun) : an inclination to do something
- (noun) : a natural inclination
- (noun) : the smallest whole number or a numeral representing this number
- (noun) : an undivided or unbroken completeness or totality with nothing wanting
- (noun) : the quality of being united into one
- اِتفاقی مطابقت مثلاً یہ معلُوم کرنے کے لیے کہ کوئی پنڈولم اپنی حرکت کِتنی دیر میں مُکمل کر لیتا ہے
More words related to the meanings of Meyl - میل
More words from English related to Meyl - میل
View an extensive list of words below that are related to the meanings of the word Meyl - میل meanings in English in English.
acceptanceacquiescenceagreementsufferanceconsentsassentationassentmentaccidentaccompanimentco operationconcurrenceconsensusconsentconsonanaceconcordcontingencyfortuitousnessfortuityliaisontemporizeventureaccordancecaduacchancecircumstancecoincidencecommunityhaphaphazardharmonymischanceopportunityunionagreeabilitycoincidingconcretionconcurrencyconsociatecoincidedconcussesconvenancecoincibencycoinheritancecoinitialcoinquinatecoinquinationcointenseaccordagreeablenessapplicability ... aptnessconformitycorrespondencehomologyidentitylikenesssimilitudecoherenceexactitudekeepingsuitablenessconsonancyrelevancecomponencycompatiblenessfellowship propitiousnessproportionatenessadaptationbehoofcompatibilityproprietyadaptabilityadaptationaladaptionadaptingadaptionsadaptsadaptablenessadaptednessadaptivenessadaptnessconformabilityconformablenessblenchchafedco operatecomportconcurcongregatecorrespondentcoupleconnectfindfretgaingetgreetkneadknitleaguemashminglemixoccurquadratetallyclubcombineconsistintroducejoinmeetobtainconfreremeetnessactuationencouragement temptationabetinducementlureaffectionfriendshipkindnessloveaffectationfamiliarityamourfondnesswooingloveredaffianceaffiliationengagementimputationrapportaffinitybetrothalcomparisoncorrelationproportionratioregardingrelationlinealityappertainconcernkinkindredcontactattachmentconnectionconnectednessconsiderationlinklinkagenexusrelatednessrelativenessconnexionappendageinterpolationaccessionalannexioncollaborationcoalitionscommunionparticipationsubscriptioncompanypartnershipcompanionshipaffinitiesadherencecommitmentdependenceaffeermentaffiancesaffiancingafflationafflationsinterpledgedissimilationintegrandintegrandsmergencemergencesmergersmergesdividendnumeratoranasconcatenationconcordancebondcohesionconsistencycontiguityconningslinkagesaffirmationavowalmaximtenetbehestdictumdogmahearsaymottopromisequotationresolvesayingstipulationtextvowwordcorculethe viewaffluentaffluxcurrenteffluxeffusionemanationflowfluidityglideoutflowdrift effluencegushissueoutpouringtideflowkdriftageflow outflowagefluidouncefluxioninflowinflowingpolluxdownflowdownflowsdriftagesdriftpindriftyeffluenceseffluvialeffluxeseffluxionsflongsfloutsflowagesfloweragefloweragesfloweretsfluidisefluidisesfluidisingfluidizingfluviatilefluxesfluxingfluxionsinterflowsonflowoutflowsoverflowspouringsreflowingreflowingsupflowupflowsfluxationtendencyinclinationpenchantpredilectionpredispositionpreferenceproclivitypropensitytrendtendancetendentialtreaguetrendinesstregetearnestnessobservationattentionclose attentionheedlikingattention gettingattentionalattenuationobtentionattentionscharmsconcentconcentusobtentionsattrectationappetitesmindednesspropendencyardent desiredesirestrong desirehabitudepleasurewishalluresalureobdurenessdipleaningpartialityvergencymindmilangradientsmelanofairhoodconduciveimporosityappositioninsertionintegrationjuxtapositionaggregate numberconfluencecouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamaccountadditioncontenderinosculationjuncturekinshipknuckleknuckle jointmarrowsolderingsumsuturetotalvampaddlesfoldedjoiningsjointsfolded upagreealikenessclickagreeableagreeablyappositeconsonantfavourable likematchablepursuantsuitableaccommodatingadvisabilecompatiblemodularwelladaptativecommensurateconformablyconformistconsentientcoincidesconcinnityconcinnousconformedpacificationmeetingconnivenceconnivencyconfederacyunanimousunitycommunicationco ordinationintercommunionintercourseinterdealintimacyapparitioncontourconfigurationconjunctureemblemeventualityfacefigureguiselikelihoodlinementmakemannerphasephasissemblancesymmetryappearancecaseconditioncountenanceformgestaltmienmodalityplightprocessshapeapproachnearnessadjacencyimmediatenessneighbourhoodproximityarounddirtcircumferencedustenvironsgookroundsurroundingbatchcrewgangguildjuntopartycrowdbignessgrossnesshugenessmagnitudebodybulkburlinesscorpulencecorpulencyheftlargenessmassivenessquantityvolumebuffetcleansedholedustpandustupdusteddustingbuddybuddysamityfriendlessnessallnessbefriendedfriendedbefriendmentunfriendshipcouncilassemblyassociationconsortiumgrouporganisationsocietyassociationalcomplexhorsemixedmultiplemultiplexvehiclecombinationcompoundcompoundedinkshipvesseladmixturecomburantcomposedlycompositionalcompoundingblendscompluviumcompositesconfiximmixturemixtmixtionmixtionsmixturescompaginationcompromisealliancereunificationunanimityalliaceouscoalitionunificationunionisationunioniseunionismunionizationunitisationalliancesunionisesunionisingunionizesunitednessunitionintenerationunitudeunivocacyunivocationconjuctioninterfluenceconfluxcrossroadconfluentsconfluxesanalogyresemblenceseemingvicinityanalogicalanalogisesimmplenessanalogiseslikinresemblantresembledsimilisedsimilisessimilisingsimilizedsimilizingsimulcastsadjacenceanalogicalnessanalogismsimilitudinaryidentificationconformanceconformationcoordinationmusicconcertconsonanceassimilatoryco ordinatecoherencycohesivenesscomatosenesscompanionabilitycompanionablenesscompliancyconcomitanceconformismcongenialitycontemporaneitycontemporaneousnesscoordinatingcovalencecovalencycovariancecurlinessharmonicharmonicalharmonicsharmoniousnessharmonisationharmonisedharmonizationharmonizeharmonizedintegumentintemperatenessneighborlinessneighbourlinesssymmetrisesymphonisesynchroneitysynchronicitysynchronismsynclinalsyncopationsyncopesyncreticsyncreticalsyncretisesyncretismsyncretisticsynergeticsynergismsynonymysynsemantictongsunneighborlinessasswagingcoeternalcogencecoherencescoheringcohesionscohobatingcohyponymcoignedcompearantconcordialharmoniesharmonisesharmonizessyncarpysynchsynchssynchysissynclinalssynclinesynclinessyncopicsyncssyndingsynecticssynergicsynergisedsynergisessynergizedsynergizessyngamoussyngamysyngeneticsynonymiesamabilitycoadjustmentcoadventurecobelligerentcoessentialitycoeternitycoevouscohesibilitycompurgatorialconcomitancyconcordableconcordancyconcorporateconcorporationconcurrentnessconducivenessconsortshipcontemporarinesscontorniatecoordinatenesscordialnessincongruenceincoordinateintegumationintegumentationomniformitysamelinesssompnoursymmetrizedsynchronicalsynchronisticsynchronologysynclinicalsyncopatingsyncrisissynonymalstoopassentwillingnessconspiremachinatecolludemanoeuvreplotframe upconspiringplotteringplottingcontaminationfilthinessimpiousnessdirtinessuncleanlinessimpurenessincapacitatinguncleannessincapacitationcontaminantfeculency nastinessfilthnight soilobscenenesssoilsullagebiliousnessblubberydiscountenanceensilefilthilyfriabilityphreaticplatitudinousslathersnappishlysnappishnessstultificationathanasyexsectionsexsectsphoresyplatitudessmotherysnafflingsnappilytabefyunswatheablatitiousabliguritionapplotmentfilietyfriationfuliginosityinviolacyrokeagestupefiednesstumultuarinesstumultuationcontextpurportspurporttenorarrangementmethodmodeordersystemwaycopulationcontrastoppugnancyoppositioncompetitionconfrontationcontestconstestationfightingparagonreciprocitycontesteecompetingcontescontestscounteredcounterfortspouseteamyokeequalduetduoscongruenceobstrictionpactbetgambleprovisionprovisostaketermwagerprerequisitestipuleconspiracycollusionnexusesrheumiercompetitoremulousenemy jeereroppositerivalvieradversaryanticontestantnemesisopponentrivalrouspredialrivalessrivalisedrivalizedrivalledrivallessrivuletsbivalvousrivoseconventionspitefulcontractcovenantindenturemisetreatyaccordantcomintcontract outcontracturecontretempsdeal outdealignmentaccordancyaccordedcontratecovenantedcovenanteecovenantsdealbatedealbationtenderisesaccordmentbon accordcontractednessincontractedpledgepromiseepromisedthe promisecumaccompanying withalongwithtogetherwithwithyalongstwithingconversationcommixturecourtshipcourtshipssycophantcycoordinatorcooperationcontributivecooperativenesscohibitedcohibitingcooperagecomportancecomportationcontrivementsupportationconfederationfederationfederalisationfederalisefederalizationfederatedfederacyfederariefederatesfederatingfederalizedfederal corbelwantjigtantamountcomparablemixturetemperinterfusionassimilationcombinatorialhybridmiscellaneousblendedcross breedhalf bredhotchpotchmingledmishmashmixed updalliancemixingdateepochtimeageepoqueeragageperiodreignpactioncoventspledgeablepledgetstenespamentstithdagdirty grimemiremoilmudtarnishdingydreggishdrossyfilthyfrouzygrimyimpuremuddynastyopacoussloventurbiduliginousfairfiestafoul sloppilysloppiersloppiestslopyslumpysloppymuckcorruptiondepravityexcrementimpurityordureimpropernessimpuritiesmilmalashearth gravelandvaluelessvestigialshovelshovelsknoutlashoffscouringrefuserubbishscraptrashwastrelwhiplerotwhiptrottennesspollutionsqualordinginessdumpinessfoul uplitterbugmoultermulishnessmussinessruntinessshitlessslursmudgysqualidnessthe shitstubbinessturbidityturgiditydumpishdundersdungydutchesfudhoolyhummuseshumuseslittermatelittersmessesmessiermessingmessmatesmoggymollitiesmorsurescumberscurrilescuttershitssiltationsludgiersludgiestslummerslurbslurringsmoodgesmudginesssnirtlesnudgesondagesquilgeedsulphationsulphurisetubbishtumbrelstumularydrengagedulcenessfurilemitingodoramentodoratingsulphurationsulphureitytubuluretumulositywarefulnessmarshoozequamiresludgegaumquaggyslimesopmudcatmuddercraunchesmuddedmuddersmuddiesmuddyingsmudgesmudsmudwortsmuntslimessludgesmorassquicksandquagmiresloughswampbogfenquagsumpwetlandmarsh felwortmarsh wrenswamp gumswamp mallowswamphenswamplandcharingembruingmarshalcymarshesmarshinessmarshlandsmarshmanmarshwortsquaggierquaggiestquagginessquagmiredquagmiresquagmiringquagmiryquagsswampedswamperswampersswampierswampiestswampinessswampingswamplandsswampsinductilitydrabbleimbruetaintdefileinfectmaculatedraff dregdrosshollowmarcfaecesgarbagehogwashoffalredundanceremainderscumwasteweirdungenemarovingcandlewickelectric lightwickequivalent againstconversematchingplausiveobvolutedversalcompunctiousheremiticaloblocutorewer foregoingprecedentbackforegonepreviousantecedenceantecedencyanteriorityprefixantecessorantevertantetempleexcedentretrocedentfalsification promisuousnessadulterationinterminglingintermixturefarrago pyekedgereemedleymelangehumanismfriendlyfusessmutblacknessclonusclonusesleaguedleagueredliggedaresayokassentingconcretiseconcretizecontactualcitationisotopeparallelpremonitoryvotarysecondmakingnaturesynthesiscompositionconstructiondecoctioninventionplanreciperusetricksyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismpeermilemonotheismmergeronenessunitsecanimusimplicationintentintentionmeaningobjectpointsignificaionwillmeantanswerobverserefusalrejectionrejoinderreplyresponserespondencerespondencyburialclaygroundterraclayeyregur soilsoilingsoilureclayedclayishclaypanclaysearthedearthinesssoilingssoilsclayesmatiesweepinglitterraffleriff rafftintacceptancesacceptedacknowledgementconfirmationconsentedratificationrecognitionsanctionaccretedsolemn promiseententeunderstandingcontumacycontumelyconstruescontraflowcontusingcontrafissureacquaintanceadulterydebasementadulteratingbingleblendingmatedminglingblendingsmactationsmingingminglementminglesminglingsmixednesscontributioncorporationattenddeclarationrapprochementreconsecrationassistancefavourcivilitycourtesyregardbasenessnefariousnessturpitudeviciousnesswickednessbefitbehoovesuitcalkcalquebrotherhoodfraternityrelationshipcadencemelodyrhythmsullybondingtiessingularity
Idioms related to the meaning of Meyl - میل
What are the meanings of Meyl - میل in English?
Meanings of the word Meyl - میل in English are affiliation, afflux, agreeableness, agreement, co operation, concurrence, confluence, conformity, consonanace, contiguity, combination, coincidence, coalitions, dirt, fellowship, filth, friendship, grime, junction, league, liaison, match, mile, mindedness, mixture, symmetry, tendency, amity, dirtiness, dross, harmony, inducement, propensity, unity, maile, mel, miles and sullage. To understand how would you translate the word Meyl - میل in English, you can take help from words closely related to Meyl - میل or it’s English translations. Some of these words can also be considered Meyl - میل synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Meyl - میل. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Meyl - میل in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Meyl - میل in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Meyl - میل with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by meyl?
Meanings of meyl are affiliation, afflux, agreeableness, agreement, co operation, concurrence, confluence, conformity, consonanace, contiguity, combination, coincidence, coalitions, dirt, fellowship, filth, friendship, grime, junction, league, liaison, match, mile, mindedness, mixture, symmetry, tendency, amity, dirtiness, dross, harmony, inducement, propensity, unity, maile, mel, miles and sullage
Whats the definition of meyl?
Definition of the meyl are
- the act of becoming formally connected or joined
- a social or business relationship
- a temperamental disposition to be agreeable
- pleasantness resulting from agreeable conditions
- harmony of people's opinions or actions or characters
- compatibility of observations
- the thing arranged or agreed to
- the statement (oral or written) of an exchange of promises
- the verbal act of agreeing
- the determination of grammatical inflection on the basis of word relations
- the temporal property of two things happening at the same time
- agreement of results or opinions
- a state of cooperation
- acting together, as agents or circumstances or events
- a flowing together
- a place where things merge or flow together (especially rivers)
- a coming together of people
- concurrence of opinion
- acting according to certain accepted standards
- correspondence in form or appearance
- orthodoxy in thoughts and belief
- hardened conventionality
- the attribute of being so near as to be touching
- the attribute of being so near as to be touching
- the act of combining things to form a new whole
- the act of arranging elements into specified groups without regard to order
- a collection of things that have been combined; an assemblage of separate parts or qualities
- an alliance of people or corporations or countries for a special purpose (formerly to achieve some antisocial end but now for general political or economic purposes)
- a group of people (often temporary) having a common purpose
- a sequence of numbers or letters that opens a combination lock
- a coordinated sequence of chess moves
- the temporal property of two things happening at the same time
- the quality of occupying the same position or area in space
- an event that might have been arranged although it was really accidental
- obscene terms for feces
- disgraceful gossip about the private lives of other people
- the part of the earth's surface consisting of humus and disintegrated rock
- (of roads) not leveled or drained; unsuitable for all year travel
- the state of being with someone
- an association of people who share common beliefs or activities
- money granted (by a university or foundation or other agency) for advanced study or research
- any substance considered disgustingly foul or unpleasant
- a state characterized by foul or disgusting dirt and refuse
- an offensive or indecent word or phrase
- the state of being friends (or friendly)
- make soiled, filthy, or dirty
- the state of being joined together
- the shape or manner in which things come together and a connection is made
- an act of joining or adjoining things
- the place where two or more things come together
- something that joins or connects
- an association of sports teams that organizes matches for its members
- an association of states or organizations or individuals for common action
- an obsolete unit of distance of variable length (usually 3 miles)
- unite to form a league
- a channel for communication between groups
- a usually secretive or illicit sexual relationship
- a pair of people who live together
- bring two objects, ideas, or people together
- make equal, uniform, corresponding, or matching
- a person who is of equal standing with another in a group
- be equal to in quality or ability
- make correspond or harmonize
- lighter consisting of a thin piece of wood or cardboard tipped with combustible chemical; ignites with friction
- an exact duplicate
- a burning piece of wood or cardboard
- something that resembles or harmonizes with
- a formal contest in which two or more persons or teams compete
- the score needed to win a match
- provide funds complementary to
- be equal or harmonize
- give or join in marriage
- set into opposition or rivalry
- a footrace extending one mile
- a Swedish unit of length equivalent to 10 km
- an ancient Roman unit of length equivalent to 1620 yards
- a large distance
- a former British unit of length equivalent to 6,080 feet (1,853.184 meters); 800 feet longer than a statute mile
- a unit of length used in navigation; exactly 1,852 meters; historically based on the distance spanned by one minute of arc in latitude
- a unit of length equal to 1,760 yards or 5,280 feet; exactly 1609.344 meters
- a former British unit of length once used in navigation; equivalent to 6,000 feet (1828.8 meters)
- any foodstuff made by combining different ingredients
- a collection containing a variety of sorts of things
- the act of mixing together
- an event that combines things in a mixture
- (chemistry) a substance consisting of two or more substances mixed together (not in fixed proportions and not with chemical bonding)
- balance among the parts of something
- (physics) the property of being isotropic; having the same value when measured in different directions
- (mathematics) an attribute of a shape or relation; exact reflection of form on opposite sides of a dividing line or plane
- an attitude of mind especially one that favors one alternative over others
- an inclination to do something
- a characteristic likelihood of or natural disposition toward a certain condition or character or effect
- a general direction in which something tends to move
- a cordial disposition
- a state of friendship and cordiality
- obscenity in speech or writing
- the state of containing dirty impurities
- the state of being unsanitary
- worthless or dangerous material that should be removed
- agreement of opinions
- a harmonious state of things in general and of their properties (as of colors and sounds); congruity of parts with one another and with the whole
- compatibility in opinion and action
- an agreeable sound property
- the structure of music with respect to the composition and progression of chords
- a positive motivational influence
- act of bringing about a desired result
- a disposition to behave in a certain way
- an inclination to do something
- a natural inclination
- the smallest whole number or a numeral representing this number
- an undivided or unbroken completeness or totality with nothing wanting
- the quality of being united into one
- اِتفاقی مطابقت مثلاً یہ معلُوم کرنے کے لیے کہ کوئی پنڈولم اپنی حرکت کِتنی دیر میں مُکمل کر لیتا ہے
What is the synonym of meyl?
Synonym of word meyl are سمبندھ, تعلق, نسبت, الحاق, اشتراک, رفاقت, وابستگی, انضمام, شرکت, میل
What are the idioms related to meyl?
Here are the idioms that are related to the word meyl.
- A journey of a thousand miles begins with one step
- Love and lordship no fellowship
- Standing pools gather filth
- After dinner sit a while after supper walk a mile
- An ill agreement is better than bad judgement