Naqsh - نقش meanings in English
Naqsh - نقش meanings in English are emblem, stamp, picture, painting, inscription, impression, features, engraving, charm, carving, step, semblance, motto, mark, embowelment Naqsh - نقش in English. More meanings of naqsh - نقش, it's definitions, example sentences, related words, idioms and quotations.
emblem stamp picture painting inscription impression features engraving charm carving step semblance motto mark embowelment
Naqsh - نقش Definitions
Please find 102 English and 1 Urdu definitions related to the word Naqsh - نقش.
- (noun) : creating figures or designs in three dimensions
- (noun) : removing parts from hard material to create a desired pattern or shape
- (noun) : a sculpture created by removing material (as wood or ivory or stone) in order to create a desired shape
- (noun) : attractiveness that interests or pleases or stimulates
- (noun) : something believed to bring good luck
- (noun) : a verbal formula believed to have magical force
- (verb) : control by magic spells, as by practicing witchcraft
- (verb) : induce into action by using one's charm
- (verb) : protect through supernatural powers or charms
- (noun) : (physics) one of the six flavors of quark
- (noun) : special design or visual object representing a quality, type, group, etc.
- (noun) : a visible symbol representing an abstract idea
- (noun) : the impression created by doing something unusual or extraordinary that people notice and remember
- (noun) : the shortest of the four Gospels in the New Testament
- (noun) : a visible indication made on a surface
- (noun) : a written or printed symbol (as for punctuation)
- (noun) : Apostle and companion of Saint Peter; assumed to be the author of the second Gospel
- (noun) : formerly the basic unit of money in Germany
- (noun) : a perceptible indication of something not immediately apparent (as a visible clue that something has happened)
- (noun) : a reference point to shoot at
- (noun) : something that exactly succeeds in achieving its goal
- (noun) : a distinguishing symbol
- (noun) : an indication of damage
- (verb) : make or leave a mark on
- (verb) : designate as if by a mark
- (verb) : notice or perceive
- (verb) : establish as the highest level or best performance
- (verb) : mark with a scar
- (verb) : attach a tag or label to
- (verb) : to accuse or condemn or openly or formally or brand as disgraceful
- (verb) : remove from a list
- (verb) : put a check mark on or near or next to
- (noun) : a marking that consists of lines that cross each other
- (verb) : celebrate by some ceremony or observation
- (verb) : imagine; conceive of; see in one's mind
- (noun) : a visual representation (of an object or scene or person or abstraction) produced on a surface
- (noun) : a typical example of some state or quality
- (noun) : illustrations used to decorate or explain a text
- (noun) : a situation treated as an observable object
- (noun) : graphic art consisting of an artistic composition made by applying paints to a surface
- (noun) : a clear and telling mental image
- (noun) : a graphic or vivid verbal description
- (verb) : show in, or as in, a picture
- (noun) : a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
- (noun) : a representation of a person or scene in the form of a print or transparent slide or in digital format
- (noun) : an outward or token appearance or form that is deliberately misleading
- (noun) : an erroneous mental representation
- (noun) : picture consisting of a graphic image of a person or thing
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : making engraved or etched plates and printing designs from them
- (noun) : a block or plate or other hard surface that has been engraved
- (noun) : a print made from an engraving
- (noun) : an outward appearance
- (noun) : a clear and telling mental image
- (noun) : a concavity in a surface produced by pressing
- (noun) : the act of pressing one thing on or into the surface of another
- (noun) : an impressionistic portrayal of a person
- (noun) : (dentistry) an imprint of the teeth and gums in wax or plaster
- (noun) : all the copies of a work printed at one time
- (noun) : a symbol that is the result of printing or engraving
- (noun) : a short message (as in a book or musical work or on a photograph) dedicating it to someone or something
- (noun) : the activity of inscribing (especially carving or engraving) letters or words
- (noun) : letters inscribed (especially words engraved or carved) on something
- (noun) : graphic art consisting of an artistic composition made by applying paints to a surface
- (noun) : the occupation of a house painter
- (noun) : the act of applying paint to a surface
- (noun) : creating a picture with paints
- (noun) : the distinctive form in which a thing is made
- (verb) : raise in a relief
- (noun) : a device incised to make an impression; used to secure a closing or to authenticate documents
- (verb) : walk heavily
- (verb) : treat or classify according to a mental stereotype
- (noun) : a symbol that is the result of printing or engraving
- (noun) : something that can be used as an official medium of payment
- (noun) : a block or die used to imprint a mark or design
- (noun) : machine consisting of a heavy bar that moves vertically for pounding or crushing ores
- (noun) : a small adhesive token stuck on a letter or package to indicate that that postal fees have been paid
- (noun) : a small piece of adhesive paper that is put on an object to show that a government tax has been paid
- (noun) : a type or class
- (verb) : destroy or extinguish as if by stamping with the foot
- (verb) : affix a stamp to
- (verb) : crush or grind with a heavy instrument
- (verb) : reveal clearly as having a certain character
- (verb) : to mark, or produce an imprint in or on something
- (verb) : form or cut out with a mold, form, or die
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words related to the meanings of Naqsh - نقش
More words from English related to Naqsh - نقش
View an extensive list of words below that are related to the meanings of the word Naqsh - نقش meanings in English in English.
acmecircumscriptionendfrontierlimitoutskirtrangesurpasstermterminusbarrierboundaryedge limitationmarchmarkmeteat mostoutgoingquantityutmostbounderishboundslimitarianlimitourlimuleacupunctureaffectationairsartificialityemblazonryparadeshowinessactclaptrapdisplayglossostentationpretencepretentionseemingseemingnesssemblanceshowshow offsplurgeveneerpretendingpretensepretences ... pretendantpretenderspretendspretensesshewingpretendencepretendershippretensedpretextureaffectionjointurebullacachetchopimpresssealstampsunserailmohraffirmationavowalmaximtenetagreementbehestconsentdictumdogmahearsaymottopromisequotationresolvesayingstipulationtextvowwordcorculethe viewaphorismapothegmcategoryepigraphmotscitationmotthesisadagebywordproverbproverbsprobitprokeprokedprokingproverproverbedproverbingproversapparitioncontourconfigurationconjunctureemblemeventualityfacefigureguiselikelihoodlinementmakemannerphasephasissymmetryappearancecaseconditioncountenanceformgestaltlikenessmienmodalityplightprocessshapeeffigy ideasimilitudeaspectdiagramfeatureformationget upimagemakingmodemodelnumeralpatternstatevarietywayshape upamorphismbannerensignescharflagmicroshibbilethsymbolvestigebadgeinsignialabelmedalscarsignsignaltraceemblemaemblementsemblemiseemblemisesemblemsnotchbacknotchesnotchingscardblotchblemishblotblotscauterizationcauterydiscolorationflecktainttarnishebotchbrandcalamitygriefinfamylossmaculamoilespeckspotstainstigmablemishedindentionmolalitystainerstainingblemishesmolalitiesscarringstainersstainingsstainsstintsstunstarnsblemishmentblowcoupknocklickbangbashbeatinghithurtimpressioninjurykickmultiplicationstrokewhangzapmultiphasemultiplicativelymultipliedmultiplesmultipletmultiplieszubrcaptivatecharmdeludefascinateglamourintriguecauterizecauterizingfiringsearshootfiremaculatecarvingcorrosioncuttingerosionmordacityacuitybitecountercounter movecutdamagedisconnectionenmityincisionrejoindersharpnessslashchop offcut outcut upcutoutcottfabricceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackpicturesquenessattractivenesscomelinesscharm quarkcharismcoaxenamourenticealluredecoyhypnotiseinveigleseducetrainwin overchartdrawingmapmodulemouldprofiletenorcopydelineationdesignexamplefeaturesplanportraitpredicamentprospectsketchindraftengraftationcinemamoviespicturetalkiescinematiseclueeurekafindingfoot stepquestsinquiryquestsearchzeteticpruriencybudgercoatcardteraphimsculpturestatuetableiconicillustrationpaintingphotographpicpicaresquepicotpicturedpicturingportraiturephotoedpicotedpicoteepicotspicrapicratepicratespicricpicritepicritespicsportraysphotocontextphraseologydictioninscriptionnarrationstylewordingcompositionexpressionphrasewordagewritingconjurationdiabolism magicconjuringenchantmentgramaryhocus pocusjugglingspellwitchcraftbewitchmentconjuremagic spellsorceryenchantsjugginsjuggledjugglesjugglingsmagickedmagickingmagicsmagpiesspealwitchenwitwallsgorcescorcecompanyeffectactioncaptorgovernanceimpactinfluenceruintoucheffervescencyaffectednesseffectivityeffectoreffectuationeffendieffervesceeffervescingimpactiontake effecteffaceseffeireffierceeffingefforceeffrayeffseffulgeseffusesrefluenceseffectioneffectuatingeffectuoseeffeteffluencyconformancesimilaritysimilaritiescruxdifficultyinnjourneylegstagecriteriondiscriminationdistinctnessidentificationidentifiesacquaintancediscernmentexperienceidentityindicationknowledgerecognitiontokenhallmarksintituleintitulescognatenesshognosesnakeintinctivityirrecognitionrecognitoryrecognizabilityrecognizationrecognoscediesynopsiscaricaturedraft monkeyoutlineschemaoutlinedsketchersketchinessoutlayingoutlinearoutlinesoutliningsketchedsketchiersketchingtableauxunderlinedunderlinesmanurementear markidolidolspresageprognosticationsymptomiconindicationskenningomenemblematicalsymbolatrysymbolisationsymbolisersymbolistsymbolizationsymbologysymbololatryemblemataepitomicalsymbionsymbiontsymbolicssymbolisedsymbolizedsymbolledsymptosisemolumentalignomysymbalsymbolisticmonumentbook markcatch wordgiftissuekeepsakemementomemorialoffspringremembrancesouveniroutsmartedsimulacrumenslavethrallensilagingenslavesenslavingepitaph gravestoneheadstoneepistlemissiveshaveingletterlinenoteepistlerletterurelettruretracktreadfootfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsfoot pacefootfallfootstepmeasurepacestridesteedsstetsyardp.a.paborderconfineborderlinegeometrydocumentinditementcomponecomposeswristerwritabilitygestureaccomplishedbeautyblandishmentcoquetryfulfilledgracepaidperformedpostureimplantincuselimnlimningengravingcarvelcarveryembalmingsembossersemboweringengraftsengrailsengravenembolismalembolismaticembolismaticalembowelingengraffmentengrailmentresemblenceluredomesticatehabituateinuretameobligationslawruleprinciplesprincipiationprinciplingramentembellishedobservancefattymotivosuppressionmeasuresInitiativesnurtureamusebrightendandledinefeastfeedferdingoutnessenchantravishregistersignetimprintprintseal impressionshadowinesssupersedeeffectivenessimpressivenessimpetrationimpressionabilityimpressionablenesstalismanamuletfetishamuleticamuletstalismansululationsamolitionaffectimpressureaimblankbuttgoalobjectobjectiveoffertargettargeattractionglorysplendourconsolevisagedemarcatedenotedentstriketickmark downemblemingemblemizeemblemizesemblemizingdiggingexcavationmonogramtughraembroiderysweetheartenterwritelineamentfootprintdotting pen
Idioms related to the meaning of Naqsh - نقش
What are the meanings of Naqsh - نقش in English?
Meanings of the word Naqsh - نقش in English are carving, charm, emblem, mark, motto, picture, semblance, step, engraving, impression, inscription, painting, stamp, features and embowelment. To understand how would you translate the word Naqsh - نقش in English, you can take help from words closely related to Naqsh - نقش or it’s English translations. Some of these words can also be considered Naqsh - نقش synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Naqsh - نقش. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Naqsh - نقش in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Naqsh - نقش in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Naqsh - نقش with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by naqsh?
Meanings of naqsh are carving, charm, emblem, mark, motto, picture, semblance, step, engraving, impression, inscription, painting, stamp, features and embowelment
Whats the definition of naqsh?
Definition of the naqsh are
- creating figures or designs in three dimensions
- removing parts from hard material to create a desired pattern or shape
- a sculpture created by removing material (as wood or ivory or stone) in order to create a desired shape
- attractiveness that interests or pleases or stimulates
- something believed to bring good luck
- a verbal formula believed to have magical force
- control by magic spells, as by practicing witchcraft
- induce into action by using one's charm
- protect through supernatural powers or charms
- (physics) one of the six flavors of quark
- special design or visual object representing a quality, type, group, etc.
- a visible symbol representing an abstract idea
- the impression created by doing something unusual or extraordinary that people notice and remember
- the shortest of the four Gospels in the New Testament
- a visible indication made on a surface
- a written or printed symbol (as for punctuation)
- Apostle and companion of Saint Peter; assumed to be the author of the second Gospel
- formerly the basic unit of money in Germany
- a perceptible indication of something not immediately apparent (as a visible clue that something has happened)
- a reference point to shoot at
- something that exactly succeeds in achieving its goal
- a distinguishing symbol
- an indication of damage
- make or leave a mark on
- designate as if by a mark
- notice or perceive
- establish as the highest level or best performance
- mark with a scar
- attach a tag or label to
- to accuse or condemn or openly or formally or brand as disgraceful
- remove from a list
- put a check mark on or near or next to
- a marking that consists of lines that cross each other
- celebrate by some ceremony or observation
- imagine; conceive of; see in one's mind
- a visual representation (of an object or scene or person or abstraction) produced on a surface
- a typical example of some state or quality
- illustrations used to decorate or explain a text
- a situation treated as an observable object
- graphic art consisting of an artistic composition made by applying paints to a surface
- a clear and telling mental image
- a graphic or vivid verbal description
- show in, or as in, a picture
- a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
- a representation of a person or scene in the form of a print or transparent slide or in digital format
- an outward or token appearance or form that is deliberately misleading
- an erroneous mental representation
- picture consisting of a graphic image of a person or thing
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- making engraved or etched plates and printing designs from them
- a block or plate or other hard surface that has been engraved
- a print made from an engraving
- an outward appearance
- a clear and telling mental image
- a concavity in a surface produced by pressing
- the act of pressing one thing on or into the surface of another
- an impressionistic portrayal of a person
- (dentistry) an imprint of the teeth and gums in wax or plaster
- all the copies of a work printed at one time
- a symbol that is the result of printing or engraving
- a short message (as in a book or musical work or on a photograph) dedicating it to someone or something
- the activity of inscribing (especially carving or engraving) letters or words
- letters inscribed (especially words engraved or carved) on something
- graphic art consisting of an artistic composition made by applying paints to a surface
- the occupation of a house painter
- the act of applying paint to a surface
- creating a picture with paints
- the distinctive form in which a thing is made
- raise in a relief
- a device incised to make an impression; used to secure a closing or to authenticate documents
- walk heavily
- treat or classify according to a mental stereotype
- a symbol that is the result of printing or engraving
- something that can be used as an official medium of payment
- a block or die used to imprint a mark or design
- machine consisting of a heavy bar that moves vertically for pounding or crushing ores
- a small adhesive token stuck on a letter or package to indicate that that postal fees have been paid
- a small piece of adhesive paper that is put on an object to show that a government tax has been paid
- a type or class
- destroy or extinguish as if by stamping with the foot
- affix a stamp to
- crush or grind with a heavy instrument
- reveal clearly as having a certain character
- to mark, or produce an imprint in or on something
- form or cut out with a mold, form, or die
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of naqsh?
Synonym of word naqsh are نَقاشی, کاٹ, تَراش, سَنگ تَراشی, نقش, فریفتہ کرنا, دلفریبی, دلکشی, الربائی, دل آویزی
What are the idioms related to naqsh?
Here are the idioms that are related to the word naqsh.
- Step after step the ladder is ascended
- Step by step one goes far
- Music the fiercest grief can charm
- Stamp out
- On painting and fighting look afar off