Numaayaan - نمایاں meanings in English
Numaayaan - نمایاں meanings in English are leading, salient, underscored, visible, featureless, saliency, salientian, featous, outmarched, salients, explicative, mirificent, praenominical, prominent, observable, noticeable, protrudent, pronounced, signal, telling, ace, characteristic, clear, conspicous, evident, illustrious, marked, noteworthy, patent Numaayaan - نمایاں in English. More meanings of numaayaan - نمایاں, it's definitions, example sentences, related words, idioms and quotations.
leading salient underscored visible featureless saliency salientian featous outmarched salients explicative mirificent praenominical prominent observable noticeable protrudent pronounced signal telling ace characteristic clear conspicous evident illustrious marked noteworthy patent
Numaayaan - نمایاں Definitions
Please find 100 English and definitions related to the word Numaayaan - نمایاں.
- (noun) : a serve that the receiver is unable to reach
- (noun) : one of four playing cards in a deck having a single pip on its face
- (noun) : someone who is dazzlingly skilled in any field
- (noun) : the smallest whole number or a numeral representing this number
- (verb) : serve an ace against (someone)
- (verb) : play (a hole) in one stroke
- (verb) : score an ace against
- (adjective satellite) : of the highest quality
- (noun) : proteolytic enzyme that converts angiotensin I into angiotensin II
- (noun) : a major strategic headquarters of NATO; safeguards an area extending from Norway to Turkey
- (noun) : a distinguishing quality
- (noun) : any measurable property of a device measured under closely specified conditions
- (noun) : the integer part (positive or negative) of the representation of a logarithm; in the expression log 643 = 2.808 the characteristic is 2
- (adjective) : typical or distinctive
- (noun) : a prominent attribute or aspect of something
- (verb) : become clear
- (noun) : the state of being free of suspicion
- (verb) : pass an inspection or receive authorization
- (verb) : pass by, over, or under without making contact
- (verb) : go away or disappear
- (verb) : sell
- (verb) : be debited and credited to the proper bank accounts
- (verb) : clear from impurities, blemishes, pollution, etc.
- (verb) : free from payment of customs duties, as of a shipment
- (verb) : remove the occupants of
- (verb) : remove (people) from a building
- (verb) : rid of instructions or data
- (verb) : make clear, bright, light, or translucent
- (verb) : settle, as of a debt
- (verb) : free (the throat) by making a rasping sound
- (verb) : remove
- (verb) : make a way or path by removing objects
- (verb) : yield as a net profit
- (verb) : go unchallenged; be approved
- (verb) : rid of obstructions
- (verb) : earn on some commercial or business transaction; earn as salary or wages
- (verb) : pronounce not guilty of criminal charges
- (verb) : make as a net profit
- (verb) : grant authorization or clearance for
- (adjective satellite) : easily deciphered
- (adjective satellite) : clear of charges or deductions
- (adjective satellite) : free from flaw or blemish or impurity
- (adjective satellite) : characterized by freedom from troubling thoughts (especially guilt)
- (adjective satellite) : free from confusion or doubt
- (adjective) : free from clouds or mist or haze
- (adjective satellite) : characterized by ease and quickness in perceiving
- (adjective satellite) : clear and distinct to the senses; easily perceptible
- (adjective satellite) : freed from any question of guilt
- (adjective satellite) : free of restrictions or qualifications
- (adjective) : accurately stated or described
- (adverb) : in an easily perceptible manner
- (adjective) : readily apparent to the mind
- (adjective) : allowing light to pass through
- (adjective satellite) : (especially of a title) free from any encumbrance or limitation that presents a question of fact or law
- (adjective satellite) : free from contact or proximity or connection
- (adjective satellite) : capable of being seen or noticed
- (adjective satellite) : clearly revealed to the mind or the senses or judgment
- (noun) : thin strip of metal used to separate lines of type in printing
- (noun) : the activity of leading
- (adjective) : going or proceeding or going in advance; showing the way
- (adjective satellite) : having the leading position or higher score in a contest
- (adjective satellite) : indicating the most important performer or role
- (adjective satellite) : greatest in importance or degree or significance or achievement
- (adjective satellite) : capable of being seen or noticed
- (noun) : a document granting an inventor sole rights to an invention
- (noun) : an official document granting a right or privilege
- (verb) : obtain a patent for
- (verb) : grant rights to; grant a patent for
- (verb) : make open to sight or notice
- (adjective satellite) : (of a bodily tube or passageway) open; affording free passage
- (adjective satellite) : clearly revealed to the mind or the senses or judgment
- (adjective satellite) : strongly marked; easily noticeable
- (noun) : (military) the part of the line of battle that projects closest to the enemy
- (adjective) : (of angles) pointing outward at an angle of less than 180 degrees
- (adjective satellite) : represented as leaping (rampant but leaning forward)
- (verb) : be a signal for or a symptom of
- (noun) : any incitement to action
- (noun) : an electric quantity (voltage or current or field strength) whose modulation represents coded information about the source from which it comes
- (verb) : communicate silently and non-verbally by signals or signs
- (adjective satellite) : notably out of the ordinary
- (noun) : any nonverbal action or gesture that encodes a message
- (adjective satellite) : producing a strong effect
- (noun) : disclosing information or giving evidence about another
- (noun) : informing by words
- (noun) : an act of narration
- (adjective satellite) : powerfully persuasive
- (adjective satellite) : disclosing unintentionally something concealed
- (adjective satellite) : present and easily available
- (adjective) : capable of being seen; or open to easy view
- (adjective satellite) : lacking distinguishing characteristics or features
- (adjective satellite) : strongly marked; easily noticeable
- (adjective satellite) : singled out for notice or especially for a dire fate
- (adjective) : having or as if having an identifying mark or a mark as specified; often used in combination
- (adjective satellite) : worthy of attention because interesting, significant, or unusual
- (adjective satellite) : capable of being detected
- (adjective) : capable or worthy of being noticed
- (adjective satellite) : conspicuous in position or importance
- (noun) : the state of being salient
- (noun) : any of various tailless stout-bodied amphibians with long hind limbs for leaping; semiaquatic and terrestrial species
- (adjective) : relating to frogs and toads
More words related to the meanings of Numaayaan - نمایاں
More words from English related to Numaayaan - نمایاں
View an extensive list of words below that are related to the meanings of the word Numaayaan - نمایاں meanings in English in English.
ablativeapparentbrilliantevidentilluminateillustriousirradiantlightlucentlucidlustrousopensshinysparklysunnyablazebrightclearexplicitilluminatedlitluminescentluminousshiningsplendidenkindledlightedbrightenedbrighterbrightsomeillimitedillumedilluminedilluminesilluminguplightedwightedilluminousabove allformerhostageleadingpalmaryprimalprimogenialprincipalvanguardbestexcellentfirst ... above boardbroadlyopenlyovertlydistinct downrightstraightdiscernibleglaringaceoddcabakkaacquaintedknownobviousaffirmationavowaldissertationeclaircissementillustrationstatementaccountallegationarticleconspicousdeclarationdescriptiondetailexplanationmanifestationnarrationspeechdelineatedexplicationdescribingepitriteoutlastedperorateddecorticatedexauthorationstateprisonafflictivedispleasingdistressful grievoushurtfulirksomemolestfulmortifyingpeskyspinysuffertedioustiresomebalefullamentablenastypainfultellingtroublesomeuncomfortablevexatiousagonizingdisparagingmelancholicsorelysufferablesuppurating soretrablouswearilyafflictingaggrievingagogicarillateddrawlinglyhurtledhurtlingpainfullerpainimspaintiestpaintyprepollentscrievingsororisingsuffusingtediousometedisometenuioustravailingtressiesttribbletusklessaccompletiveachilousafflicterafflictivelyaffrontinglycorollaceousdisaffectingdiscomfortablediscomfortingdisconvenientgastfulharanguefulincalescentincumbrousintrovenientirretrievablenessmelancholiouspainablepainsworthypangfulperlaceousplaguefulsorceringsuffisanttardigradousteenfultemptatioustenebrificoustortuloustorvoustractitioustralatitiouslytravailoustressfultretabletrispermoustristigmatictrous de louptrowelfultumulousaggravatedarchbigbroadcardinalcrackegregiousenormousforemostgrandgreatgrosshugehugeousimmenseimportantmainmajormicklesignalsizablesuperiorvastelderextensivegiantlargemassiveoldsterportlypresbyterultrawidebiggerbiggishoverseriousoversizeoversizedbiggedbiggingoversizeslargetagloweffulgentflashyglitteringsparkishfulgentgarishgaudyglossylivelyluculentrutilantsheenslicktawdryirradiateaflameconspicuouslyimplyoutsideovertclearlydisclosedmanifestopenostensiblepalpablepatentplainprominentsalientseemingnessunderscoredundisputedvisibleevinceposingdisplayedflagrantobviouslypubliclyappreciableclerklyfirst rategrandeemagnificentmasterlynicepicturesquechoicefine freshgoodneatnoblerespectablesoundsterlingunadulteratedsublimelyexcelledexergualouttalkfineeroblectateoftensithplethoricalarticulatacandidcleanlydiaphanous empyrealfoolproofguilelessimpartiallimpidsinceresmugtaint freetaintlesstidywhistlecleandirect distinctly evenexpresslyfairingenuouslegibleplainlypurestraightforwarduncontaminatedbrushedcleanableclearedneatenunbrushedbrushlesscleanedcleanscleansedcleansescleatedneapedneatenedneaterpurfledpurgedpurledrefiguredrepinedsanifiedsweepytiddyunswatheswipedperfectavailableeffectiveefficaciousmortallyoperativebanneremblemensignescharflagmarkmicroshibbilethsymbolvestigebadgeinsignialabelmedalscarsigntraceemblemaemblementsemblemiseemblemisesemblemsnotchbacknotchesnotchingscardbadeemarvellousphenomenalselectcurioinfrequentnovelpeculiarpreciousraresingularuncommonunfrequentuniqueuntypicalunusualunwontednadderdifferenteminenthonouredpre eminentstatesmenchosencrackingdiagnosticdiscriminatedistinguishedexaltedloftymarkednotableobservableoutstandingprosilientdifferentiateddenominativelyindistinguishedsupereminentfranklylegiblymanifestlynakedlyplumpbarelyexplicitlyoutrightunambiguousunambiguouslyunequivocalunequivocallyexotericexpandedloosenakeduncoveredunlockedunrestrictedwide openopeneduncloakedunkedcharacteristiccharacterepithettraita lotprettyquiterathermettlegunkparticularisticparticularitycharacterycharacterismcharacteristicalcharacterizingfeatnesscrystalhyalinetransparentpellucidtransfluenttranspicuouscrystal clearmicaceousbrinyflaskfulglabrousglazedshinnydazzlingsglintedglisteredglitteredglitzygloweredglozedgluishglutenoussheensshiniershoneensspeckygalsomeglomeroussparkfulimmaculatespotlessstainlessinnocentirreproachableunblemishedvirginzero defecthairlessskinlessspecklessspotlesslystemlessunbarredscarlessshredlessshunlessspirelesstielessblemishlessblotlesssteedlesssteerlessconsciousknowingproficientskilfulversantaccomplishedadeptadroitartisandeftdextrousexperthandylearnedmasterskilledversedspecialiserspecialisticspecializersuffragistastringerversingadeptistapicianexcommunicantexuperantskilderdexterousconsiderablenoteworthydecerptiblecountablesignificantchiefcriticalmeaningfulmomentousurgentvitalpreeminentprolusorysignificativeedificialpointyambiparousconsignificantedificantimportuouspignorativepointalsignificatesignificatoryvitaliccrescentfamouscelebratednotoriouswell knownnomiaavowedfabulousfamedhistoriclegendarynamednotedproclaimedputativeaccoutredcelestiterenownedfathomedrenownersrenowningreputedcelebriousfamblefamousedfamularfamulistrenownfulreprehensiveimmanifestemblematicblatantclear cutexpressnudepronouncedtactileunmistakeablevividclearheadedconspicuousesurientevidentialevitablefrangibleopepepandurateperspicuousreferentblarneyedblathererclartyclearerclearesteidentelucidatedelusoryesterifiedevidentsevincedevincesevincingevinciveevoluteevolutivefrankedopificeropificersostentvividestdistinctiveefficient ownspecialspecialstheclosedefiniteespecialexclusiveextraordinaryfavouriteparticularpersonalprivatespecificapicularparticularmentdrasticimpetuousoppressiveoutrageousoverpoweringseverestringentterrificvehementviolentacuteextremeextremelygraveharshheavyheftyheinousinclementintenserigourousvigorousvitallywild eyedintensionalfioritureintensatedintensitiveforcefulhigh soundingimpressivevirtuousmaleficialsplendentsunlitgenerousgentlegentlemangrandsirehoaryprimogenitorsenoirvenerableagedoldrespectedsenioraristocrataristocraticeldelderberryelderlyeldoradoeldershipseldineldingeldingseldinseldssaintshipelderisheldernelderwortopertaneousespeciallyprecedentprecursoryprimatepriorsquirtingprecedingpredecessorpremierprimeprivilegedgainborncreateddiscoveredfoundprocuredgeneratedarticulatereservoirrevictualmightyleadleadershipcommandhegemonylead upleadedbeautifulelegantponderousoutwardvisualvisoredvisilevisiveprotrudentdeterminedstipuledindeterminedreptiliousillustrousrememberableallusionbeckconnotationgestgesturehinthunchimplicationindicationinklinginnuendoinsinuationmentionquotereferencetwinklewaftagewarningwatchwordwinkwrinklealludeallusivenessdenotationgestategesturalpointednessalludingbeckingbeckonsbecksdenotateddenoteddenotementgeistgestantgestatedgestativegestatorygesturedindicatingindictingnointpointingsprompterspromptestpromptingssignifyingsignpostedgeestgesticulatedgesticulatorygesturelessgesturementinchestindiceindoinindorsationpointilismtenaciousfastfirmfortifiedinconvertiblestrengthenedtestimonialcertificatecharterdegreediploma documentimprimaturproofqualificationtestamentwritcertceritecertitudesferlyincomparableinimitablematchlesssingleunequalledunparalleledbold letterssashwhiteinterestingsparklingundrewexpurgatorydistinguishing characteristicdramaticworkerguidancemootnoticeablenoticeabilityperceptiblevirile
Idioms related to the meaning of Numaayaan - نمایاں
What are the meanings of Numaayaan - نمایاں in English?
Meanings of the word Numaayaan - نمایاں in English are ace, characteristic, clear, evident, illustrious, leading, observable, patent, protrudent, pronounced, salient, signal, telling, visible, featureless, marked, noteworthy, noticeable, prominent, saliency, salientian, featous, outmarched, salients, explicative, mirificent, praenominical, conspicous and underscored. To understand how would you translate the word Numaayaan - نمایاں in English, you can take help from words closely related to Numaayaan - نمایاں or it’s English translations. Some of these words can also be considered Numaayaan - نمایاں synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Numaayaan - نمایاں. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Numaayaan - نمایاں in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Numaayaan - نمایاں in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Numaayaan - نمایاں with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by numaayaan?
Meanings of numaayaan are ace, characteristic, clear, evident, illustrious, leading, observable, patent, protrudent, pronounced, salient, signal, telling, visible, featureless, marked, noteworthy, noticeable, prominent, saliency, salientian, featous, outmarched, salients, explicative, mirificent, praenominical, conspicous and underscored
Whats the definition of numaayaan?
Definition of the numaayaan are
- a serve that the receiver is unable to reach
- one of four playing cards in a deck having a single pip on its face
- someone who is dazzlingly skilled in any field
- the smallest whole number or a numeral representing this number
- serve an ace against (someone)
- play (a hole) in one stroke
- score an ace against
- of the highest quality
- proteolytic enzyme that converts angiotensin I into angiotensin II
- a major strategic headquarters of NATO; safeguards an area extending from Norway to Turkey
- a distinguishing quality
- any measurable property of a device measured under closely specified conditions
- the integer part (positive or negative) of the representation of a logarithm; in the expression log 643 = 2.808 the characteristic is 2
- typical or distinctive
- a prominent attribute or aspect of something
- become clear
- the state of being free of suspicion
- pass an inspection or receive authorization
- pass by, over, or under without making contact
- go away or disappear
- sell
- be debited and credited to the proper bank accounts
- clear from impurities, blemishes, pollution, etc.
- free from payment of customs duties, as of a shipment
- remove the occupants of
- remove (people) from a building
- rid of instructions or data
- make clear, bright, light, or translucent
- settle, as of a debt
- free (the throat) by making a rasping sound
- remove
- make a way or path by removing objects
- yield as a net profit
- go unchallenged; be approved
- rid of obstructions
- earn on some commercial or business transaction; earn as salary or wages
- pronounce not guilty of criminal charges
- make as a net profit
- grant authorization or clearance for
- easily deciphered
- clear of charges or deductions
- free from flaw or blemish or impurity
- characterized by freedom from troubling thoughts (especially guilt)
- free from confusion or doubt
- free from clouds or mist or haze
- characterized by ease and quickness in perceiving
- clear and distinct to the senses; easily perceptible
- freed from any question of guilt
- free of restrictions or qualifications
- accurately stated or described
- in an easily perceptible manner
- readily apparent to the mind
- allowing light to pass through
- (especially of a title) free from any encumbrance or limitation that presents a question of fact or law
- free from contact or proximity or connection
- capable of being seen or noticed
- clearly revealed to the mind or the senses or judgment
- thin strip of metal used to separate lines of type in printing
- the activity of leading
- going or proceeding or going in advance; showing the way
- having the leading position or higher score in a contest
- indicating the most important performer or role
- greatest in importance or degree or significance or achievement
- capable of being seen or noticed
- a document granting an inventor sole rights to an invention
- an official document granting a right or privilege
- obtain a patent for
- grant rights to; grant a patent for
- make open to sight or notice
- (of a bodily tube or passageway) open; affording free passage
- clearly revealed to the mind or the senses or judgment
- strongly marked; easily noticeable
- (military) the part of the line of battle that projects closest to the enemy
- (of angles) pointing outward at an angle of less than 180 degrees
- represented as leaping (rampant but leaning forward)
- be a signal for or a symptom of
- any incitement to action
- an electric quantity (voltage or current or field strength) whose modulation represents coded information about the source from which it comes
- communicate silently and non-verbally by signals or signs
- notably out of the ordinary
- any nonverbal action or gesture that encodes a message
- producing a strong effect
- disclosing information or giving evidence about another
- informing by words
- an act of narration
- powerfully persuasive
- disclosing unintentionally something concealed
- present and easily available
- capable of being seen; or open to easy view
- lacking distinguishing characteristics or features
- strongly marked; easily noticeable
- singled out for notice or especially for a dire fate
- having or as if having an identifying mark or a mark as specified; often used in combination
- worthy of attention because interesting, significant, or unusual
- capable of being detected
- capable or worthy of being noticed
- conspicuous in position or importance
- the state of being salient
- any of various tailless stout-bodied amphibians with long hind limbs for leaping; semiaquatic and terrestrial species
- relating to frogs and toads
What is the synonym of numaayaan?
Synonym of word numaayaan are اکا, اکلو, ممتاز, ماہر, نمایاں, احسن, تاش کا اکّا, یکا, یکتا, خاصہ
What are the idioms related to numaayaan?
Here are the idioms that are related to the word numaayaan.
- A self evident truth requires no proof
- Marked with a t
- Visible means
- It is no use telling to stonwalls
- No tale so good but may be spoiled in telling