Patti - پٹی meanings in English
Patti - پٹی meanings in English are stryphnic, tape, tab, stripe, strip, strap, screed, row, ribbon, rand, position, thong, trick, strippet, patee, yirded, strout, stripings, stripier, putti, streep, stipe, zone, plaster, part, band, tenure, teaching, table, ligature, ligamen, holding, girth, farm, compress, belt, clamp, list, line, lath, kersey, inkle, headband, fraud, eye wash, deligation, deception, bandage Patti - پٹی in English. More meanings of patti - پٹی, it's definitions, example sentences, related words, idioms and quotations.
stryphnic tape tab stripe strip strap screed row ribbon rand position thong trick strippet patee yirded strout stripings stripier putti streep stipe zone plaster part band tenure teaching table ligature ligamen holding girth farm compress belt clamp list line lath kersey inkle headband fraud eye wash deligation deception bandage
Patti - پٹی Definitions
Please find 187 English and 2 Urdu definitions related to the word Patti - پٹی.
- (noun) : a restraint put around something to hold it together
- (noun) : a strip of material attached to the leg of a bird to identify it (as in studies of bird migration)
- (noun) : a range of frequencies between two limits
- (noun) : instrumentalists not including string players
- (noun) : jewelry consisting of a circlet of precious metal (often set with jewels) worn on the finger
- (noun) : a group of musicians playing popular music for dancing
- (noun) : an unofficial association of people or groups
- (verb) : bind or tie together, as with a band
- (verb) : attach a ring to the foot of, in order to identify
- (noun) : a thin flat strip of flexible material that is worn around the body or one of the limbs (especially to decorate the body)
- (noun) : an adornment consisting of a strip of a contrasting color or material
- (noun) : a driving belt in machinery
- (noun) : a stripe or stripes of contrasting color
- (noun) : a cord-like tissue connecting two larger parts of an anatomical structure
- (noun) : a thin flat strip or loop of flexible material that goes around or over something else, typically to hold it together or as a decoration
- (noun) : a piece of soft material that covers and protects an injured part of the body
- (verb) : dress by covering or binding
- (verb) : wrap around with something so as to cover or enclose
- (verb) : impose or inflict forcefully
- (verb) : fasten or fix with a clamp
- (noun) : a device (generally used by carpenters) that holds things firmly together
- (verb) : make more compact by or as if by pressing
- (verb) : squeeze or press together
- (noun) : a cloth pad or dressing (with or without medication) applied firmly to some part of the body (to relieve discomfort or reduce fever)
- (noun) : workplace consisting of farm buildings and cultivated land as a unit
- (verb) : collect fees or profits
- (verb) : be a farmer; work as a farmer
- (noun) : stable gear consisting of a band around a horse's belly that holds the saddle in place
- (verb) : tie a cinch around
- (noun) : the distance around a person's body
- (noun) : something owned; any tangible or intangible possession that is owned by someone
- (noun) : the act of retaining something
- (noun) : thread used by surgeons to bind a vessel (as to constrict the flow of blood)
- (noun) : a metal band used to attach a reed to the mouthpiece of a clarinet or saxophone
- (noun) : character consisting of two or more letters combined into one
- (noun) : (music) a group of notes connected by a slur
- (noun) : the act of tying or binding things together
- (noun) : a conceptual separation or distinction
- (noun) : persuasive but insincere talk that is usually intended to deceive or impress
- (verb) : cover the interior of
- (noun) : a course of reasoning aimed at demonstrating a truth or falsehood; the methodical process of logical reasoning
- (noun) : a slight depression or fold in the smoothness of a surface
- (noun) : the property possessed by a line or surface that departs from the vertical
- (verb) : cause to lean to the side
- (noun) : a database containing an ordered array of items (names or topics)
- (verb) : tilt to one side
- (verb) : include in a list
- (verb) : give or make a list of; name individually; give the names of
- (verb) : discontinue an association or relation; go different ways
- (noun) : an actor's portrayal of someone in a play
- (noun) : something determined in relation to something that includes it
- (verb) : come apart
- (verb) : force, take, or pull apart
- (noun) : one of the portions into which something is regarded as divided and which together constitute a whole
- (noun) : the actions and activities assigned to or required or expected of a person or group
- (noun) : something less than the whole of a human artifact
- (noun) : the melody carried by a particular voice or instrument in polyphonic music
- (noun) : the extended spatial location of something
- (noun) : assets belonging to or due to or contributed by an individual person or group
- (verb) : leave
- (noun) : a line of scalp that can be seen when sections of hair are combed in opposite directions
- (noun) : that which concerns a person with regard to a particular role or situation
- (noun) : the effort contributed by a person in bringing about a result
- (adverb) : to some extent; in some degree; not wholly
- (verb) : go one's own way; move apart
- (noun) : an award for winning a championship or commemorating some other event
- (noun) : notion consisting of a narrow strip of fine material used for trimming
- (noun) : a long strip of inked material for making characters on paper with a typewriter
- (noun) : any long object resembling a thin line
- (noun) : a linear array of numbers, letters, or symbols side by side
- (verb) : lay bare
- (verb) : remove all contents or possession from, or empty completely
- (verb) : take away possessions from someone
- (verb) : remove (someone's or one's own) clothes
- (verb) : take off or remove
- (noun) : artifact consisting of a narrow flat piece of material
- (noun) : a form of erotic entertainment in which a dancer gradually undresses to music
- (noun) : thin piece of wood or metal
- (noun) : a relatively long narrow piece of something
- (noun) : a sequence of drawings telling a story in a newspaper or comic book
- (noun) : an airfield without normal airport facilities
- (verb) : remove the surface from
- (verb) : strip the cured leaves from
- (verb) : draw the last milk (of cows)
- (verb) : remove a constituent from a liquid
- (verb) : remove the thread (of screws)
- (verb) : get undressed
- (noun) : V-shaped sleeve badge indicating military rank and service
- (noun) : a kind or category
- (noun) : a piece of braid, usually on the sleeve, indicating military rank or length of service
- (verb) : mark with stripes
- (noun) : an adornment consisting of a strip of a contrasting color or material
- (noun) : a narrow marking of a different color or texture from the background
- (verb) : hold back to a later time
- (noun) : a piece of furniture having a smooth flat top that is usually supported by one or more vertical legs
- (noun) : a piece of furniture with tableware for a meal laid out on it
- (noun) : a set of data arranged in rows and columns
- (noun) : a company of people assembled at a table for a meal or game
- (noun) : food or meals in general
- (noun) : flat tableland with steep edges
- (verb) : arrange or enter in tabular form
- (noun) : a long thin piece of cloth or paper as used for binding or fastening
- (noun) : a recording made on magnetic tape
- (noun) : measuring instrument consisting of a narrow strip (cloth or metal) marked in inches or centimeters and used for measuring lengths
- (noun) : the finishing line for a foot race
- (noun) : memory device consisting of a long thin plastic strip coated with iron oxide; used to record audio or video signals or to store computer information
- (verb) : fasten or attach with tape
- (verb) : register electronically
- (verb) : record on videotape
- (noun) : the bill in a restaurant
- (noun) : a dose of medicine in the form of a small pellet
- (noun) : a short strip of material attached to or projecting from something in order to facilitate opening or identifying or handling it
- (noun) : sensationalist journalism
- (noun) : the key on a typewriter or a word processor that causes a tabulation
- (noun) : a doctrine that is taught
- (noun) : the profession of a teacher
- (noun) : the activities of educating or instructing; activities that impart knowledge or skill
- (noun) : the right to hold property; part of an ancient hierarchical system of holding lands
- (noun) : the term during which some position is held
- (verb) : give life-time employment to
- (verb) : regulate housing in; of certain areas of towns
- (noun) : (anatomy) any encircling or beltlike structure
- (noun) : an area or region distinguished from adjacent parts by a distinctive feature or characteristic
- (noun) : any of the regions of the surface of the Earth loosely divided according to latitude or longitude
- (verb) : separate or apportion into sections
- (noun) : a locally circumscribed place characterized by some distinctive features
- (noun) : a vigorous blow
- (noun) : the act of hitting vigorously
- (noun) : a band to tie or buckle around the body (usually at the waist)
- (noun) : endless loop of flexible material between two rotating shafts or pulleys
- (noun) : ammunition (usually of small caliber) loaded in flexible linked strips for use in a machine gun
- (noun) : an elongated region where a specific condition or characteristic is found
- (noun) : a path or strip (as cut by one course of mowing)
- (verb) : fasten with a belt
- (verb) : deliver a blow to
- (verb) : sing loudly and forcefully
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : something intended to deceive; deliberate trickery intended to gain an advantage
- (noun) : intentional deception resulting in injury to another person
- (noun) : a band worn around or over the head
- (noun) : a linen tape used for trimming as a decoration
- (noun) : a narrow thin strip of wood used as backing for plaster or to make latticework
- (verb) : coat with plaster
- (noun) : adhesive tape used in dressing wounds
- (noun) : a medical dressing consisting of a soft heated mass of meal or clay that is spread on a cloth and applied to the skin to treat inflamed areas or improve circulation etc.
- (noun) : a surface of hardened plaster (as on a wall or ceiling)
- (verb) : dress by covering with a therapeutic substance
- (verb) : apply a heavy coat to
- (verb) : apply a plaster cast to
- (verb) : affix conspicuously
- (verb) : cover conspicuously or thickly, as by pasting something on
- (noun) : a mixture of lime or gypsum with sand and water; hardens into a smooth solid; used to cover walls and ceilings
- (noun) : any of several gypsum cements; a white powder (a form of calcium sulphate) that forms a paste when mixed with water and hardens into a solid; used in making molds and sculptures and casts for broken limbs
- (noun) : the arrangement of the body and its limbs
- (noun) : the act of putting something in a certain place
- (noun) : the post or function properly or customarily occupied or served by another
- (noun) : the particular portion of space occupied by something
- (noun) : United States writer (born in Russia) noted for her polemical novels and political conservativism (1905-1982)
- (noun) : a rocky region in the southern Transvaal in northeastern South Africa; contains rich gold deposits and coal and manganese
- (noun) : the basic unit of money in South Africa; equal to 100 cents
- (noun) : an accurately levelled strip of material placed on a wall or floor as guide for the even application of plaster or concrete
- (noun) : a long piece of writing
- (noun) : a long monotonous harangue
- (noun) : supporting stalk or stem-like structure especially of a pistil or fern frond or supporting a mushroom cap
- (verb) : beat severely with a whip or rod
- (noun) : whip consisting of a strip of leather used in flogging
- (noun) : an elongated leather strip (or a strip of similar material) for binding things together or holding something in position
- (noun) : a band that goes over the shoulder and supports a garment or bag
- (verb) : secure (a sprained joint) with a strap
- (verb) : sharpen with a strap
- (verb) : tie with a strap
- (noun) : hanger consisting of a loop of leather suspended from the ceiling of a bus or train; passengers hold onto it
- (noun) : United States film actress (born in 1949)
- (noun) : a backless sandal held to the foot by a thong between the big toe and the second toe
- (noun) : leather strip that forms the flexible part of a whip
- (noun) : minimal clothing worn by stripteasers; a narrow strip of fabric that covers the pubic area, passes between the thighs, and is supported by a waistband
- (noun) : a thin strip of leather; often used to lash things together
- (noun) : underpants resembling a G-string; worn by women especially under very tight pants
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- ساٹن یا کپڑے کا پتلا سا فیتہ جو بطور آرایش یا باندھنے کے لیے استعمال کیا جائے
- مُختلف رنگوں کی بطور علامت لگائی گئی پٹیاں
More words related to the meanings of Patti - پٹی
More words from English related to Patti - پٹی
View an extensive list of words below that are related to the meanings of the word Patti - پٹی meanings in English in English.
abstinenceairlessbandagebankbreakwatercrampdamimpassableimprisonmentjointletligamenligaturemanacleobstaclepiecepierbondclosedcopuladikedykehoopligamentshuttightunopenedverseweirbound offclose downclose offclose outclosedowncloselippedcloseoutclosingclosing offdiscontinuedetchedfoist offoffhandedshut awayshutoutshutteredshuttingspiel offceasingclosetedcloseting ... closuredcloyedestopinclosesoffedoffingsquitedseinedshutsunclosedclosehandedclosehauledcollopedaccompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxinessfraudknacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaffixbucklecalculatecementcomputecombineconnectcomposeconjoinconnectsekeembodyfeigngatherhoardhookjoinlinkmortiseputtysplicestoretacktapewaferaddannexappendattachconjugateinosculateinterconnectinventknitpatchuniteadductingaddlingappendingconjoiningensembleslinkingenlinksejunctionbandfastengirdimputemoortiebindchaincongealincurwindbind overtie uptyingagricultureculturecultivationfarmfarmingtilthagribusinessagrobiologyagrologyagromaniaagaricsagraffeagrimoniesagriologyagronomicsaviculturecroplandcroppiesagrarianismagricolationagriculturismagrostographyagrostologycorrodibilityincultureuncultureairinessdilatationdistensiongirthroominessvastnessprosperitywidenessexsiliencyappendantcoronaedge facing garnishgarnitureglossarymargemouldingpurflebordercommentaryfootnotehemmarginrandretinuemarginalitymarginocephaliamarginocephalianmarginsmarginicidalappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedcommonfieldlistmadianmaidarace coursearenagroundopen fieldplainarenasarenationsarmedcincturegirdlewaist bandsashzostercummerbundimposturejugglerymachinationcircumventiondeceptionguilequackerypearlinesschouscross bitehoaxhypocrisyillusionjugglelegerdemainshamcheatingdeceitdeceivingdouble dealingfallowgriftliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationcheatfeint huskbangblewchastisedashdrub flapknocklynchmasterovercomeputtbeathitjugulatekillknucklesmitestrapstrikezaphittingstrokingbashingbatinghitheskippingsloshessmitsmitingsmittingsmoteto beatmalleatemaulribroastruetaborbashbatterbruiseclobbercontusecurrydefeatdingpoundpunishtickletrouncewallopwhackwhompwhopyerkbeatingbaronyfiefbasketcyclicalienationdistancelineremotenessawaynessfarawaynessoutdistancedistancingdirenessdistancydistantialditionfartherancebatchdrivelspitspwalbulkheaplotmasssalivaspittlesputumwholesalesalivarysalivationsaligotssalivassalivatesspatstelesalethowelthoricbrimbrinkoutskirtsea soreselvagecoastedgingendfringe limitrimriver bankshoresidevergegulpmorselmouthfulribbonblindkorcorcoversbroochcomponentcrumblivelihoodmodicumsegmenttatterbitdabfractionfragmentfritterpartportiontruncheonfragmentiseslice upminimentpiecenpiecenedpiecenerpieceningsnippetysnippiersnippiestpiecelybroildiscorddisputedissension entanglementquarrelrumpusruckusstrifeconflictcontestdisuniondisunityfeud fightgainsayhasslejarkick uplitigationrowsquabblewranglewranglingbrawquarrelsomenesssquigglebrawlingbrawlingsbrawlsclasherdisplesfeudedfeudingfrizemiffingquarlequarrenderquarriablequarrionscufflesscufflingscuffstiffingbranglementdisrayquarlquarreletquarrelingquarrellousspighttuefallaltercationsbullyclenchconstrictdismayenforcehumiliateimportuneoutflyoverbalanceoverbearovermasteroverpowerpinchastrictcompressgripehush upoppresspressquellquenchrepressreprimerestrainsmothersuppressweigh downpress onbutingredientparticlecalculationcipheringcomputationbillestimateestimationratereckoningscoretallyaccountedreckonedrecountedmusternumerationcountingnicknumberingceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomfashiongaitgimmickryindirectionshenaniganstratagemtacticwalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktracktrapbluffgimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakecatchdelusioneye washfallacyimpositionjapechiefchairchargedesignationdutyofficepostrankdesignmentassithmentbetrayaldouble crossbeltclitorisjesstrunkboondogglechestholsterthongpattypeatybaelpietiespatteewaterdiversion duplicityhoodwinkingsophistryburnscivilizationedificationeducationteachinginternshiptrainingupbringinginstructorshiptrainingscircuitconstituencyleaguorverticilambitannulusfraternitygrouploopnooseringwardhalakahcinchfastlimitednarrownarrowishclosecongesteddistressedharassedincapaciousstraitenedcrampednarrow downnarrowednarrowingstraitlacedanglicisedcrampetnarrowcastnarrowernarrowsstintystraggledstraikedstrampedtangedtantaloustightishweiredcircumlocutiondifferenceturningwindingclampclutchencroachmentgraspgripholdkeepingmanubriummasteryoccupancyoccupationhafthandlehilthingeknuckle jointpossessingpossessionpowerseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivalclasscommunitycrewfactiongangguildhordepartytribebunchcliqueherdaggroupconglobecliquescohortscongruegroupageaggroupmentcordpack clothtagtemptbracesstretchtightenclamviseclamperracktortureclausgapchinkclausecleaveagecleftcrackcrannycrevice fissurehiatusincisionkindopeningrentriftrimasortsplitclausalclausulaclausulaeclausurecoatcarddrawingemblazonryemblemimagetableiconicillustrationpaintingphotographpictureportraitpicpicaresquepicotpicturedpicturingportraiturephotoedpicotedpicoteepicotspicrapicratepicratespicricpicritepicritespicsportraysphotocushionnapeocciputhassocknoddlenuchapadpillionwadassholeassholesshacklehandfastseizingzipfastenersfasteningsconsumptionhomesteadwar fieldfarmplacefarmedfarmeressfarmeryporgerancheriefieldycontingentdividendquotadealdoleproportionquantumsectionsharetakepartakespartitivespartagefiletelegramyarncablewirestrungstrigstringendostringersstringingstringingsstruntstarrefillet leashpackthreadtwinegimpsnarestringdorydoreedurriecostiveholderoccupieroccupanttenanttenantsastringentconstipatinglandholderpossessivepossessorecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitycorduroystringscordagescordingscordwaindordurestroupstringinesscropcultivated landcrackersmashing beautydiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangedisarraydoffpeelstripunclotheundresscoildilemmafoldindirectnessmazemisfortunerevolutiontorsionturntwistyawndragdraweduce trailabsorbbrewdistildrag longhaullugpulldistilldraw awayintrenchmentpull uppullingpullulateratchsnarl upstragglingstretchingcrampingscatchdretcheretationintrenchingpruinatepullendurationlengthperiodtermtimewhileperiodatetenuresduelgymnasiumtournamentdwellinghomelieusitewhereaboutabnormalhaltlocationlocusnicheoccasionplacestationstatusiconsimulacrumembrocationointmentplasterspackleunctionlappleplaspepistlemissiveshaveinglettermarknoteepistlerletterurelettrureestateownershippropertyownedproprietorshipproprietressproprioceptionconsortismownershipspossessoryentorganismentortilationproprietieslumbagochuckschakhumbuginsincerityquizfeaturefeatureddouradurafleetseriestrainfloglashstripemercuryquicksilverscrapshredtrooptroupeobjectiontakingvalencycriticismgrapplelockgripesgripinggrippingcapturinggrabsgracinggraipgraipsgrapinggraspergraspsgrikegripedgrippergripsgripplenesssplinterlathgrudgehostilitytaxanimosityantagonismattachmentcorrelationill feelingintrigueloveplotloggepretextdevicedisguise excusequibbletrepanhocusmonopolyhostsewcassiadarnhatchstitchsenajugglingsleightknaverydesidiousdesidiousnesskerseylectionlessoninstructionlecturetuitiondurrastextuaryducturerabateligateblindfoldswaddleguyhalterropetowropeyrophyropingropytowingthreadjotsnippetcirquemachinespare partmakemakingmixturesynthesistempercompositionconfigurationconstructiondecoctioninventionmethodmodeplanrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmanifestcatalogueindexinventoryscheduletable of contentsglistwaitinningopportunitymurderambushartificeoarpaddleoustsnatchspoildespoilnabniprationtwelveaboutbodylimbingphalanxrangetierorderparadearraymentqueuequeuesqueue uprowelqueestqueueingsqueuingsrowansrowersrowlocksrowthlaceribbandribbonsribstonsrelbunribansilksilkssilkenssilkieshoulder beltcurlringletstraplikestrappingleashesleashingstrackstrampstraplinestrappedstrandstring of pearlsstreakveinsuperbeingcapacityexistencetabletplankplaqueplacateplaquetteplacitknarltabtabardutterancetenancyterrainurgentlyinstantaneouslyreadilyscrimmage linelaxerlineatemillineryseventyabilityappearancecapabilitymeritprestigeaffectationbunkumfablefibfrivolous talkairscoquetryflirtingpretenceswaggeraffraybattlebrawlclashcombatcontentionenmityfraywarwrestlingcabalteambeguilementdamagelosschacmablatancyblusterhurly burlyriottumultturmoiluproarcoaxinveigleseducediscrepancymessflattenflatteningconcealconqueringcultivatemopseductionmagicmiraclefeigningpretentiondisorderquarrellingunsoundnessencrustationincrustationlaminalayerplightplyruckstratumwimplefoldawayfoldagelaynerevasion frictionexposelay bareunlidgashhackfussracketroutinkleweltchartularymultiplication tablesparkposeasanaasanasrancetimesoptimesretimestimingsdesk
Idioms related to the meaning of Patti - پٹی
What are the meanings of Patti - پٹی in English?
Meanings of the word Patti - پٹی in English are band, bandage, clamp, compress, farm, girth, holding, kersey, ligamen, ligature, line, list, part, ribbon, row, strip, stripe, table, tape, tab, teaching, tenure, zone, belt, deception, fraud, headband, inkle, lath, plaster, position, rand, screed, stipe, strap, streep, thong, trick, deligation, putti, stripier, stripings, strout, yirded, patee, strippet, stryphnic and eye wash. To understand how would you translate the word Patti - پٹی in English, you can take help from words closely related to Patti - پٹی or it’s English translations. Some of these words can also be considered Patti - پٹی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Patti - پٹی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Patti - پٹی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Patti - پٹی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Patti - پٹی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by patti?
Meanings of patti are band, bandage, clamp, compress, farm, girth, holding, kersey, ligamen, ligature, line, list, part, ribbon, row, strip, stripe, table, tape, tab, teaching, tenure, zone, belt, deception, fraud, headband, inkle, lath, plaster, position, rand, screed, stipe, strap, streep, thong, trick, deligation, putti, stripier, stripings, strout, yirded, patee, strippet, stryphnic and eye wash
Whats the definition of patti?
Definition of the patti are
- a restraint put around something to hold it together
- a strip of material attached to the leg of a bird to identify it (as in studies of bird migration)
- a range of frequencies between two limits
- instrumentalists not including string players
- jewelry consisting of a circlet of precious metal (often set with jewels) worn on the finger
- a group of musicians playing popular music for dancing
- an unofficial association of people or groups
- bind or tie together, as with a band
- attach a ring to the foot of, in order to identify
- a thin flat strip of flexible material that is worn around the body or one of the limbs (especially to decorate the body)
- an adornment consisting of a strip of a contrasting color or material
- a driving belt in machinery
- a stripe or stripes of contrasting color
- a cord-like tissue connecting two larger parts of an anatomical structure
- a thin flat strip or loop of flexible material that goes around or over something else, typically to hold it together or as a decoration
- a piece of soft material that covers and protects an injured part of the body
- dress by covering or binding
- wrap around with something so as to cover or enclose
- impose or inflict forcefully
- fasten or fix with a clamp
- a device (generally used by carpenters) that holds things firmly together
- make more compact by or as if by pressing
- squeeze or press together
- a cloth pad or dressing (with or without medication) applied firmly to some part of the body (to relieve discomfort or reduce fever)
- workplace consisting of farm buildings and cultivated land as a unit
- collect fees or profits
- be a farmer; work as a farmer
- stable gear consisting of a band around a horse's belly that holds the saddle in place
- tie a cinch around
- the distance around a person's body
- something owned; any tangible or intangible possession that is owned by someone
- the act of retaining something
- thread used by surgeons to bind a vessel (as to constrict the flow of blood)
- a metal band used to attach a reed to the mouthpiece of a clarinet or saxophone
- character consisting of two or more letters combined into one
- (music) a group of notes connected by a slur
- the act of tying or binding things together
- a conceptual separation or distinction
- persuasive but insincere talk that is usually intended to deceive or impress
- cover the interior of
- a course of reasoning aimed at demonstrating a truth or falsehood; the methodical process of logical reasoning
- a slight depression or fold in the smoothness of a surface
- the property possessed by a line or surface that departs from the vertical
- cause to lean to the side
- a database containing an ordered array of items (names or topics)
- tilt to one side
- include in a list
- give or make a list of; name individually; give the names of
- discontinue an association or relation; go different ways
- an actor's portrayal of someone in a play
- something determined in relation to something that includes it
- come apart
- force, take, or pull apart
- one of the portions into which something is regarded as divided and which together constitute a whole
- the actions and activities assigned to or required or expected of a person or group
- something less than the whole of a human artifact
- the melody carried by a particular voice or instrument in polyphonic music
- the extended spatial location of something
- assets belonging to or due to or contributed by an individual person or group
- leave
- a line of scalp that can be seen when sections of hair are combed in opposite directions
- that which concerns a person with regard to a particular role or situation
- the effort contributed by a person in bringing about a result
- to some extent; in some degree; not wholly
- go one's own way; move apart
- an award for winning a championship or commemorating some other event
- notion consisting of a narrow strip of fine material used for trimming
- a long strip of inked material for making characters on paper with a typewriter
- any long object resembling a thin line
- a linear array of numbers, letters, or symbols side by side
- lay bare
- remove all contents or possession from, or empty completely
- take away possessions from someone
- remove (someone's or one's own) clothes
- take off or remove
- artifact consisting of a narrow flat piece of material
- a form of erotic entertainment in which a dancer gradually undresses to music
- thin piece of wood or metal
- a relatively long narrow piece of something
- a sequence of drawings telling a story in a newspaper or comic book
- an airfield without normal airport facilities
- remove the surface from
- strip the cured leaves from
- draw the last milk (of cows)
- remove a constituent from a liquid
- remove the thread (of screws)
- get undressed
- V-shaped sleeve badge indicating military rank and service
- a kind or category
- a piece of braid, usually on the sleeve, indicating military rank or length of service
- mark with stripes
- an adornment consisting of a strip of a contrasting color or material
- a narrow marking of a different color or texture from the background
- hold back to a later time
- a piece of furniture having a smooth flat top that is usually supported by one or more vertical legs
- a piece of furniture with tableware for a meal laid out on it
- a set of data arranged in rows and columns
- a company of people assembled at a table for a meal or game
- food or meals in general
- flat tableland with steep edges
- arrange or enter in tabular form
- a long thin piece of cloth or paper as used for binding or fastening
- a recording made on magnetic tape
- measuring instrument consisting of a narrow strip (cloth or metal) marked in inches or centimeters and used for measuring lengths
- the finishing line for a foot race
- memory device consisting of a long thin plastic strip coated with iron oxide; used to record audio or video signals or to store computer information
- fasten or attach with tape
- register electronically
- record on videotape
- the bill in a restaurant
- a dose of medicine in the form of a small pellet
- a short strip of material attached to or projecting from something in order to facilitate opening or identifying or handling it
- sensationalist journalism
- the key on a typewriter or a word processor that causes a tabulation
- a doctrine that is taught
- the profession of a teacher
- the activities of educating or instructing; activities that impart knowledge or skill
- the right to hold property; part of an ancient hierarchical system of holding lands
- the term during which some position is held
- give life-time employment to
- regulate housing in; of certain areas of towns
- (anatomy) any encircling or beltlike structure
- an area or region distinguished from adjacent parts by a distinctive feature or characteristic
- any of the regions of the surface of the Earth loosely divided according to latitude or longitude
- separate or apportion into sections
- a locally circumscribed place characterized by some distinctive features
- a vigorous blow
- the act of hitting vigorously
- a band to tie or buckle around the body (usually at the waist)
- endless loop of flexible material between two rotating shafts or pulleys
- ammunition (usually of small caliber) loaded in flexible linked strips for use in a machine gun
- an elongated region where a specific condition or characteristic is found
- a path or strip (as cut by one course of mowing)
- fasten with a belt
- deliver a blow to
- sing loudly and forcefully
- an illusory feat; considered magical by naive observers
- the act of deceiving
- a misleading falsehood
- something intended to deceive; deliberate trickery intended to gain an advantage
- intentional deception resulting in injury to another person
- a band worn around or over the head
- a linen tape used for trimming as a decoration
- a narrow thin strip of wood used as backing for plaster or to make latticework
- coat with plaster
- adhesive tape used in dressing wounds
- a medical dressing consisting of a soft heated mass of meal or clay that is spread on a cloth and applied to the skin to treat inflamed areas or improve circulation etc.
- a surface of hardened plaster (as on a wall or ceiling)
- dress by covering with a therapeutic substance
- apply a heavy coat to
- apply a plaster cast to
- affix conspicuously
- cover conspicuously or thickly, as by pasting something on
- a mixture of lime or gypsum with sand and water; hardens into a smooth solid; used to cover walls and ceilings
- any of several gypsum cements; a white powder (a form of calcium sulphate) that forms a paste when mixed with water and hardens into a solid; used in making molds and sculptures and casts for broken limbs
- the arrangement of the body and its limbs
- the act of putting something in a certain place
- the post or function properly or customarily occupied or served by another
- the particular portion of space occupied by something
- United States writer (born in Russia) noted for her polemical novels and political conservativism (1905-1982)
- a rocky region in the southern Transvaal in northeastern South Africa; contains rich gold deposits and coal and manganese
- the basic unit of money in South Africa; equal to 100 cents
- an accurately levelled strip of material placed on a wall or floor as guide for the even application of plaster or concrete
- a long piece of writing
- a long monotonous harangue
- supporting stalk or stem-like structure especially of a pistil or fern frond or supporting a mushroom cap
- beat severely with a whip or rod
- whip consisting of a strip of leather used in flogging
- an elongated leather strip (or a strip of similar material) for binding things together or holding something in position
- a band that goes over the shoulder and supports a garment or bag
- secure (a sprained joint) with a strap
- sharpen with a strap
- tie with a strap
- hanger consisting of a loop of leather suspended from the ceiling of a bus or train; passengers hold onto it
- United States film actress (born in 1949)
- a backless sandal held to the foot by a thong between the big toe and the second toe
- leather strip that forms the flexible part of a whip
- minimal clothing worn by stripteasers; a narrow strip of fabric that covers the pubic area, passes between the thighs, and is supported by a waistband
- a thin strip of leather; often used to lash things together
- underpants resembling a G-string; worn by women especially under very tight pants
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- ساٹن یا کپڑے کا پتلا سا فیتہ جو بطور آرایش یا باندھنے کے لیے استعمال کیا جائے
- مُختلف رنگوں کی بطور علامت لگائی گئی پٹیاں
What is the synonym of patti?
Synonym of word patti are باندھنا, پرا باندھنا, اکھٹّاکرنا, پٹی, گروہ, ٹولی, باجا, جتھہ, بند, پٹاخا
What are the idioms related to patti?
Here are the idioms that are related to the word patti.
- It is a fraud to conceal a fraud
- A sleeveless er rand
- Active list
- No one attains the highest position by being faint hearted
- Patience is a plaster for all sores