Raaj - راج meanings in English
Raaj - راج meanings in English are builder, sway, state, rule, reign, realm, government, dominion, bricklayer, mason, kingship, kingdom, jurisprudence, raj Raaj - راج in English. More meanings of raaj - راج, it's definitions, example sentences, related words, idioms and quotations.
builder sway state rule reign realm government dominion bricklayer mason kingship kingdom jurisprudence raj
Raaj - راج Definitions
Please find 67 English and 1 Urdu definitions related to the word Raaj - راج.
- (noun) : someone who contracts for and supervises construction (as of a building)
- (noun) : a substance added to soaps or detergents to increase their cleansing action
- (noun) : a person who creates a business or who organizes and develops a country
- (noun) : the branch of philosophy concerned with the law and the principles that lead courts to make the decisions they do
- (noun) : the collection of rules imposed by authority
- (noun) : a basic group of natural objects
- (noun) : a monarchy with a king or queen as head of state
- (noun) : the domain ruled by a king or queen
- (noun) : a country with a king as head of state
- (noun) : a domain in which something is dominant
- (noun) : the highest taxonomic group into which organisms are grouped; one of five biological categories: Monera or Protoctista or Plantae or Fungi or Animalia
- (noun) : the dignity or rank or position of a king
- (noun) : a member of a widespread secret fraternal order pledged to mutual assistance and brotherly love
- (noun) : a craftsman who works with stone or brick
- (noun) : English writer (1865-1948)
- (noun) : English film actor (1909-1984)
- (noun) : American Revolutionary leader from Virginia whose objections led to the drafting of the Bill of Rights (1725-1792)
- (noun) : something regarded as a normative example
- (verb) : decide on and make a declaration about
- (noun) : a rule or law concerning a natural phenomenon or the function of a complex system
- (noun) : a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- (noun) : measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- (noun) : a principle or condition that customarily governs behavior
- (noun) : (mathematics) a standard procedure for solving a class of mathematical problems
- (noun) : any one of a systematic body of regulations defining the way of life of members of a religious order
- (noun) : prescribed guide for conduct or action
- (noun) : directions that define the way a game or sport is to be conducted
- (noun) : (linguistics) a rule describing (or prescribing) a linguistic practice
- (noun) : the duration of a monarch's or government's power
- (noun) : dominance or power through legal authority
- (verb) : keep in check
- (verb) : have an affinity with; of signs of the zodiac
- (verb) : decide with authority
- (verb) : mark or draw with a ruler
- (verb) : exercise authority over; as of nations
- (noun) : a craftsman skilled in building with bricks
- (noun) : a region marked off for administrative or other purposes
- (noun) : dominance or power through legal authority
- (noun) : one of the self-governing nations in the British Commonwealth
- (noun) : the study of government of states and other political units
- (noun) : the organization that is the governing authority of a political unit
- (noun) : (government) the system or form by which a community or other political unit is governed
- (noun) : the act of governing; exercising authority
- (noun) : British dominion over India (1757-1947)
- (noun) : the domain ruled by a king or queen
- (noun) : a domain in which something is dominant
- (noun) : a knowledge domain that you are interested in or are communicating about
- (noun) : the period during which a monarch is sovereign
- (noun) : a period during which something or somebody is dominant or powerful
- (verb) : have sovereign power
- (noun) : royal authority; the dominion of a monarch
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- (verb) : win approval or support for
- (noun) : pitching dangerously to one side
- (verb) : move back and forth or sideways
- (verb) : cause to move back and forth
- (noun) : controlling influence
- (verb) : move or walk in a swinging or swaying manner
- بلوائیوں کے عائد کردہ ضابطے
Example Sentences
Car garage | کار گیراج |
Labor day is to pays tribute to the greatest worker in the world, awarding time off with lively parades and festivals. | یوم مزدور دنیا کے سب سے بڑے کارکن کو خراج تحسین پیش کرنا ہے ، جس میں رواں پریڈوں اور تہواروں کے ساتھ وقت دیا جاتا ہے |
More words related to the meanings of Raaj - راج
More words from English related to Raaj - راج
View an extensive list of words below that are related to the meanings of the word Raaj - راج meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryafarapartavauntawaydatedistantly epochfarfurtheroutpastthitherultraverticityagebeyondcycledeviousdistantepoqueeraofforbitoutlyingperiodreignremotestand offfar offfar out ... afeardistancedduraffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingapparitioncontoureffigy emblemfacefigureguiseidealinementlikenessmakemannersemblancesimilitudeappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedbadeeconstructiveforgermanufacturershaperbuilderfabricantmakerblowerblowierforkermasonarchitectarchitectonicarchitectonicsarchitravearchitectsmasonsarchitectormechanicrepairmantechniciancannondutifulobligationsstatutecanonharplawordinanceregulationrulesystemlawslawklawkslawmlawndcarverceremonialcustomtraditionceremonyformalityhabitudeinstituteordinationpracticeritualwontrit.ritualiseritzyrittersrittingrittsritualizesritziestconstitutionusageecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingcasenounplighttrimconsciencejurisprudenceaimanimusintentintentionintentnessmeaningmotivepurposeresolvewillwouldconfigurationmoraltenorbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattcriterionmaximbaseetiquette formulahabitmannersmethodestablished orderprincipleobstrictionpledgetimevowagreementcontractengagementgagepromisestipulationwordpactioncoventspledgeablepledgetstenespamentstithbailiwickdominiongovernmentempire mastershipministryadministrationauthoritygovernancepowerregimeregimentgovedictfiatjurisdicationkingdomlibertymandatesequesterbehestbiddingcommandcommandmentjudicial decreedirectiveimperiumnoticeorderumpireverdictwarrantwrithakampresidentshipsovereigntystatehoodrealmstatesmanshipprincipalityemparadisesultanesssultanshipaldermancyaldermanshipempairemprisingemprisondomaineuropeguardianshipwardshipfabricatefoundconstructedifyconstructingframer authorfounderinventororiginatorfounderingfoundressfounderedfounderousfoundsgeneralglorymagnificencemajestydignityeleganceeminencegrandeurpompshanshawnseanillustriousnesspageantrykingshipmammonmoneyfortunelucremeansmoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthtenetmotmottoprinciplesprincipiationprinciplingramentpathwayportcountrynationastronomygenrelineamentphysiquecodeprocedurereulecontroldominancedominationoccupationpossessionswaydomiciliationdynamizationdegreefitkettledrumopportunitypitchturnwatchdominategovernlordmastercircarsircarsirkarsirkarskaiserdommonarchymonarchicmonarchicalmonarchismkinghoodkinglinesskingshipsmonarchialmonarchisedinarchyreigning
Idioms related to the meaning of Raaj - راج
To rule the roost | حالات پر قابو پانا حکمرانی کرنا |
What are the meanings of Raaj - راج in English?
Meanings of the word Raaj - راج in English are builder, jurisprudence, kingdom, kingship, mason, rule, bricklayer, dominion, government, raj, realm, reign, state and sway. To understand how would you translate the word Raaj - راج in English, you can take help from words closely related to Raaj - راج or it’s English translations. Some of these words can also be considered Raaj - راج synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Raaj - راج. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Raaj - راج in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Raaj - راج in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Raaj - راج with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by raaj?
Meanings of raaj are builder, jurisprudence, kingdom, kingship, mason, rule, bricklayer, dominion, government, raj, realm, reign, state and sway
Whats the definition of raaj?
Definition of the raaj are
- someone who contracts for and supervises construction (as of a building)
- a substance added to soaps or detergents to increase their cleansing action
- a person who creates a business or who organizes and develops a country
- the branch of philosophy concerned with the law and the principles that lead courts to make the decisions they do
- the collection of rules imposed by authority
- a basic group of natural objects
- a monarchy with a king or queen as head of state
- the domain ruled by a king or queen
- a country with a king as head of state
- a domain in which something is dominant
- the highest taxonomic group into which organisms are grouped; one of five biological categories: Monera or Protoctista or Plantae or Fungi or Animalia
- the dignity or rank or position of a king
- a member of a widespread secret fraternal order pledged to mutual assistance and brotherly love
- a craftsman who works with stone or brick
- English writer (1865-1948)
- English film actor (1909-1984)
- American Revolutionary leader from Virginia whose objections led to the drafting of the Bill of Rights (1725-1792)
- something regarded as a normative example
- decide on and make a declaration about
- a rule or law concerning a natural phenomenon or the function of a complex system
- a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- a principle or condition that customarily governs behavior
- (mathematics) a standard procedure for solving a class of mathematical problems
- any one of a systematic body of regulations defining the way of life of members of a religious order
- prescribed guide for conduct or action
- directions that define the way a game or sport is to be conducted
- (linguistics) a rule describing (or prescribing) a linguistic practice
- the duration of a monarch's or government's power
- dominance or power through legal authority
- keep in check
- have an affinity with; of signs of the zodiac
- decide with authority
- mark or draw with a ruler
- exercise authority over; as of nations
- a craftsman skilled in building with bricks
- a region marked off for administrative or other purposes
- dominance or power through legal authority
- one of the self-governing nations in the British Commonwealth
- the study of government of states and other political units
- the organization that is the governing authority of a political unit
- (government) the system or form by which a community or other political unit is governed
- the act of governing; exercising authority
- British dominion over India (1757-1947)
- the domain ruled by a king or queen
- a domain in which something is dominant
- a knowledge domain that you are interested in or are communicating about
- the period during which a monarch is sovereign
- a period during which something or somebody is dominant or powerful
- have sovereign power
- royal authority; the dominion of a monarch
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- win approval or support for
- pitching dangerously to one side
- move back and forth or sideways
- cause to move back and forth
- controlling influence
- move or walk in a swinging or swaying manner
- بلوائیوں کے عائد کردہ ضابطے
What is the synonym of raaj?
Synonym of word raaj are بنانے والا, راج, معمار, مستری, بانی, نیت, علم فقہ, قانون دانی, علم قانون, نیائے شاستر
What are the idioms related to raaj?
Here are the idioms that are related to the word raaj.
- It is easier to rule a kingdom than a family
- Men rule the world women rule men
- Better reign in hell than serve in paradise
- He is not a mason who refuses a stone
- Petticoat government
How to use raaj in a sentence?
Here is few example on how to use raaj in a sentence.
- Car garage — کار گیراج
- Labor day is to pays tribute to the greatest worker in the world, awarding time off with lively parades and festivals. — یوم مزدور دنیا کے سب سے بڑے کارکن کو خراج تحسین پیش کرنا ہے ، جس میں رواں پریڈوں اور تہواروں کے ساتھ وقت دیا جاتا ہے