Reyaasat - ریاست meanings in English
Reyaasat - ریاست meanings in English are empire, presidentship, rule, sovereignty, state, statehood Reyaasat - ریاست in English. More meanings of reyaasat - ریاست, it's definitions, example sentences, related words, idioms and quotations.
Reyaasat - ریاست Definitions
Please find 36 English and 1 Urdu definitions related to the word Reyaasat - ریاست.
- (noun) : an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- (noun) : a group of countries under a single authority
- (noun) : a monarchy with an emperor as head of state
- (noun) : the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- (noun) : the office and function of president
- (noun) : something regarded as a normative example
- (verb) : decide on and make a declaration about
- (noun) : a rule or law concerning a natural phenomenon or the function of a complex system
- (noun) : a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- (noun) : measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- (noun) : a principle or condition that customarily governs behavior
- (noun) : (mathematics) a standard procedure for solving a class of mathematical problems
- (noun) : any one of a systematic body of regulations defining the way of life of members of a religious order
- (noun) : prescribed guide for conduct or action
- (noun) : directions that define the way a game or sport is to be conducted
- (noun) : (linguistics) a rule describing (or prescribing) a linguistic practice
- (noun) : the duration of a monarch's or government's power
- (noun) : dominance or power through legal authority
- (verb) : keep in check
- (verb) : have an affinity with; of signs of the zodiac
- (verb) : decide with authority
- (verb) : mark or draw with a ruler
- (verb) : exercise authority over; as of nations
- (noun) : the authority of a state to govern another state
- (noun) : government free from external control
- (noun) : royal authority; the dominion of a monarch
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
More words related to the meanings of Reyaasat - ریاست
More words from English related to Reyaasat - ریاست
View an extensive list of words below that are related to the meanings of the word Reyaasat - ریاست meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryaffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingapparitioncontoureffigy emblemface ... figureguiseidealinementlikenessmakemannersemblancesimilitudeappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedbuilderjurisprudencekingdomkingshipmasonbricklayerdominiongovernmentrealmreignruleswayrajcannondutifulobligationsstatutecanonharplawordinanceregulationsystemlawslawklawkslawmlawndceremonialcustomtraditionceremonyformalityhabitudeinstituteordinationpracticeritualwontrit.ritualiseritzyrittersrittingrittsritualizesritziestconstitutionusageecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingcasenounplighttrimconfigurationmoraltenorbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattcriterionmaximbaseetiquette formulahabitmannersmethodestablished orderprincipleempire mastershipministryadministrationauthoritygovernancepowerregimeregimentgovkaiserdomemphrensykingrulershipgovernessyreignsruleredruleringrulershipsgovernablenessrule mongerstatesmanshipimperiumprincipalitysovereigntyemparadisesultanesssultanshipaldermancyaldermanshipempairemprisingemprisonbailiwickdomaingeneralglorymagnificencemajestydignityeleganceeminencegrandeurpompshanshawnseanillustriousnesspageantrymammonmoneyfortunelucremeansmoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthtenetmotmottoprinciplesprincipiationprinciplingramentpathwayportpresidentshipchairmanshippresidencypresidiarypresidencecountrynationabsolutenessautarchyautocracyastronomygenrelineamentphysiquecodeprocedurereuledegreefitkettledrumopportunitypitchtimeturnwatchdominategovernindependenceindependencyautonomiesautonymsautonomyreigning
Idioms related to the meaning of Reyaasat - ریاست
What are the meanings of Reyaasat - ریاست in English?
Meanings of the word Reyaasat - ریاست in English are empire, presidentship, rule, sovereignty, state and statehood. To understand how would you translate the word Reyaasat - ریاست in English, you can take help from words closely related to Reyaasat - ریاست or it’s English translations. Some of these words can also be considered Reyaasat - ریاست synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Reyaasat - ریاست. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Reyaasat - ریاست in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Reyaasat - ریاست in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Reyaasat - ریاست with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by reyaasat?
Meanings of reyaasat are empire, presidentship, rule, sovereignty, state and statehood
Whats the definition of reyaasat?
Definition of the reyaasat are
- an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- a group of countries under a single authority
- a monarchy with an emperor as head of state
- the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- the office and function of president
- something regarded as a normative example
- decide on and make a declaration about
- a rule or law concerning a natural phenomenon or the function of a complex system
- a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- a principle or condition that customarily governs behavior
- (mathematics) a standard procedure for solving a class of mathematical problems
- any one of a systematic body of regulations defining the way of life of members of a religious order
- prescribed guide for conduct or action
- directions that define the way a game or sport is to be conducted
- (linguistics) a rule describing (or prescribing) a linguistic practice
- the duration of a monarch's or government's power
- dominance or power through legal authority
- keep in check
- have an affinity with; of signs of the zodiac
- decide with authority
- mark or draw with a ruler
- exercise authority over; as of nations
- the authority of a state to govern another state
- government free from external control
- royal authority; the dominion of a monarch
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
What is the synonym of reyaasat?
Synonym of word reyaasat are حکومت, فرماں روائی, شہنشاہی, اختیار شاہی, راج ادھیکار, حکمرانی, ریاست, مملکت, سلطنت, قلمرو
What are the idioms related to reyaasat?
Here are the idioms that are related to the word reyaasat.
- Men rule the world women rule men
- In a state of nature
- Many laws in a state are a bad sign
- Better to rule than to be ruled by the rout
- By the rule of thumb