Saaf karna - صاف کرنا meanings in English
Saaf karna - صاف کرنا meanings in English are sanifying, descanting, blarneying, wrasse, wipe up, wipe away, scrub up, sanitise, refinish, neatening, pureeing, purfling, refiles, refile, purveying, purring, purlicuing, puritanize, purgings, purgations, purifying, purging, wash, mop, lustrate, iron, illustrate, gut, filter, cleanse, absterge, defecate, garble, purgation, desalination, deaminize, deaminization, deaminate, scour, purify, purge, clarify Saaf karna - صاف کرنا in English. More meanings of saaf karna - صاف کرنا, it's definitions, example sentences, related words, idioms and quotations.
sanifying descanting blarneying wrasse wipe up wipe away scrub up sanitise refinish neatening pureeing purfling refiles refile purveying purring purlicuing puritanize purgings purgations purifying purging wash mop lustrate iron illustrate gut filter cleanse absterge defecate garble purgation desalination deaminize deaminization deaminate scour purify purge clarify
Saaf karna - صاف کرنا Definitions
Please find 80 English and 1 Urdu definitions related to the word Saaf karna - صاف کرنا.
- (verb) : make clear by removing impurities or solids, as by heating
- (verb) : make clear and (more) comprehensible
- (verb) : clean one's body or parts thereof, as by washing
- (verb) : purge of an ideology, bad thoughts, or sins
- (verb) : run or flow slowly, as in drops or in an unsteady stream
- (noun) : device that removes something from whatever passes through it
- (noun) : an electrical device that alters the frequency spectrum of signals passing through it
- (verb) : pass through
- (verb) : make false by mutilation or addition; as of a message or story
- (noun) : a strong cord made from the intestines of sheep and used in surgery
- (noun) : the part of the alimentary canal between the stomach and the anus
- (verb) : remove the guts of
- (verb) : empty completely; destroy the inside of
- (noun) : a narrow channel or strait
- (verb) : depict with an illustration
- (verb) : clarify by giving an example of
- (verb) : supply with illustrations
- (noun) : home appliance consisting of a flat metal base that is heated and used to smooth cloth
- (noun) : a golf club that has a relatively narrow metal head
- (noun) : implement used to brand live stock
- (noun) : a heavy ductile magnetic metallic element; is silver-white in pure form but readily rusts; used in construction and tools and armament; plays a role in the transport of oxygen by the blood
- (verb) : press and smooth with a heated iron
- (adjective satellite) : extremely robust
- (verb) : make moist
- (noun) : the flow of air that is driven backwards by an aircraft propeller
- (verb) : clean with some chemical process
- (noun) : the work of cleansing (usually with soap and water)
- (noun) : any enterprise in which losses and gains cancel out
- (noun) : a watercolor made by applying a series of monochrome washes one over the other
- (noun) : a thin coat of water-base paint
- (noun) : the dry bed of an intermittent stream (as at the bottom of a canyon)
- (noun) : garments or white goods that can be cleaned by laundering
- (noun) : the erosive process of washing away soil or gravel by water (as from a roadway)
- (verb) : move by or as if by water
- (verb) : form by erosion
- (verb) : admit to testing or proof
- (verb) : be capable of being washed
- (verb) : to cleanse (itself or another animal) by licking
- (verb) : cleanse (one's body) with soap and water
- (verb) : remove by the application of water or other liquid and soap or some other cleaning agent
- (verb) : apply a thin coating of paint, metal, etc., to
- (verb) : cleanse with a cleaning agent, such as soap, and water
- (verb) : separate dirt or gravel from (precious minerals)
- (verb) : wash or flow against
- (verb) : remove the amino radical (usually by hydrolysis) from an amino compound; to perform deamination
- (noun) : removal of the amino radical from an amino acid or other amino compound
- (verb) : remove the amino radical (usually by hydrolysis) from an amino compound; to perform deamination
- (noun) : the removal of salt (especially from sea water)
- (noun) : purging the body by the use of a cathartic to stimulate evacuation of the bowels
- (noun) : the act of clearing yourself (or another) from some stigma or charge
- (noun) : a ceremonial cleansing from defilement or uncleanness by the performance of appropriate rites
- (verb) : eject the contents of the stomach through the mouth
- (verb) : rinse, clean, or empty with a liquid
- (noun) : an abrupt or sudden removal of a person or group from an organization or place
- (noun) : the act of clearing yourself (or another) from some stigma or charge
- (verb) : excrete or evacuate (someone's bowels or body)
- (verb) : rid of impurities
- (verb) : make pure or free from sin or guilt
- (verb) : clear of a charge
- (verb) : oust politically
- (noun) : an act of removing by cleansing; ridding of sediment or other undesired elements
- (noun) : the act of clearing yourself (or another) from some stigma or charge
- (adjective) : serving to purge or rid of sin
- (noun) : an act of removing by cleansing; ridding of sediment or other undesired elements
- (verb) : make pure or free from sin or guilt
- (verb) : become clean or pure or free of guilt and sin
- (adjective satellite) : acting like an antiseptic
- (adjective) : freeing from noxious matter
- (adjective) : serving to purge or rid of sin
- (verb) : give a new surface
- (verb) : make less offensive or more acceptable by removing objectionable features
- (verb) : make sanitary by cleaning or sterilizing
- (verb) : rub hard or scrub
- (verb) : rinse, clean, or empty with a liquid
- (verb) : clean with hard rubbing
- (verb) : examine minutely
- (noun) : a place that is scoured (especially by running water)
- (verb) : wash thoroughly
- (verb) : remove by wiping
- (noun) : chiefly tropical marine fishes with fleshy lips and powerful teeth; usually brightly colored
- ایک آلہ جِس کے ذریعے کِسی مائع سے ٹھوس اشیا الگ کی جاتی ہیں
More words related to the meanings of Saaf karna - صاف کرنا
More words from English related to Saaf karna - صاف کرنا
View an extensive list of words below that are related to the meanings of the word Saaf karna - صاف کرنا meanings in English in English.
abstersionablutiongalipotlustratetarwashcleansewash offaccessgutavenuewentbatheblazonemblazeenlightenflashfurbishglossillumebrightenexcitegleamirradiatepolishscourshinevarnishbrislingglossinaglowerspurge nettleaglimmerblimbingblimbingsblimyclematisesfandangleflashierflickingfunnellinggleamiestglissadingglozingpryingsrepiningsheeningtweakingtweezingglutinating ... imbureingdrawillustrateportraysketchpicturizingbroom stickbroommalkinmopswabbroom weedbroomcornbroomcorn milletbroomstickbroomweedswabbingsweep awaysweep oarsweep oversweep upbroomingbroomrapebroomrapesbroomsbroomstaffbroomyswabbedswabbysweepbacksweepbackssweepingssweepssweep sawsweepagebraveryprowessspartansmoxievaliantnessgedsjuratsspunkiespunkiesbuffetdirtdustdholedustpandustupdusteddustingcastigateadmonishbrush offsweepcarvecropdisprovedissect dividedribepitomizefoilgarblegridehoemownibblenippassripscissorwhittlebite snakechapchiselchopcleaveclipcurtailcutdeductdiscountdisjoin disuniteexcludehackimpugninciseinterruptknifemutilatenullifyoccludeopenreaprefutesevershearstrike outundergobaitingbite offbite outchop chopchopinecut tocutting outslicingbittingchoppingkiltingreapssaddlelesschopnesssootetruncatecheatedge flexionforcing pumphoaxtagtailwhiffbrawnbreathcourageendenergyextremityheftimpetusinertiainstantlifemightmomentpneumatailtempertugvitalityzaptaillechannelfirthgatstraitclarifydistingusishilluminatemanifestmake clearexplainvivifyclarifyingclathrateeviscerateexplicitnesspin downevidencingpindownelucidatingclutchesfaculty forcelustinessmightinesspepvaliantvimabilitycapabilityinputmainpowerstrengthtantamountvigourvisentirenesspotencepoweredpowerfulnessshaktistrenuositypotentisepoweringpowteredboweriesentiertypotancepotentacypotentnessstreightstrengthyvilitycovetousgrabbygutsymisermiserlyravenousvoraciousavariciousavidclose fistedcurmudgeongluttonousgrabbergraspinggreedyinsatiablecullrazeeselectchoosehewinfiltratepickpreencrawpaunchgleandish clothfilterpurgativedust clothdustertorchonclearcutnessclearnesssafenesserasersrifenessclearednesswiperdistillerductmarrow bonepipetubetuberclekindlelightlightenilluminelight uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenfemaleironironedironingironersironingsironiseironisedironisesironizedironizesleakagedrippeddriptsievesiftstrainsyewinnowsearcestrainertea makerfriskingriddledsieve outthreshingbrayedchafferedchaffingchaffinglyembarksfoistersfriskingslurkingpelvisespiddledpluckingriddedriddingriddlingriddlinglyriddlingsroisteringsecernedsievedsievessievingsorbingthicketythirlstiddledchieveshodingfilterablefilteredfilthiergloaterscleanseparatesiftgraininterpolateboldbravedashingguttymanfulventuresomeventurousimbathebathinglotiontake a showertake brunchlaveironyferrategauffering ironironiesironisingironizeironizingmaking ironlixiviatedefecatechastendepuratefinishpurgepurifysanctifiedconchyrationalizeasseverateexpatiateinterpretparaphraseannotateannotatingannulateinterpretingrinsesearchbathbatheticbatwingbathersbathesbathorsebathorseswashingunwashedwashing upwashupfloshesinswatheinswathedinswathessmutchesundashedwasheringwasherywasheswashingslaunderingabstergedry expungewipewipe outdescribeelaborateexpoundrefinesalvedecertifydemarkingdabfraudseductiontrickexemplifyexemplifying
Idioms related to the meaning of Saaf karna - صاف کرنا
You cannot wash a blackmoor white | کاگا نہ اُجلا ہوۓ چاہے نو من صابن لگاوٴ |
Wash ones hands of | ذمہ داری سے دستبر دار ہونا |
Wash ones dirty linen at home | خاندانی معاملات |
What are the meanings of Saaf karna - صاف کرنا in English?
Meanings of the word Saaf karna - صاف کرنا in English are clarify, cleanse, filter, garble, gut, illustrate, iron, lustrate, mop, wash, deaminate, deaminization, deaminize, defecate, desalination, purgation, purge, purging, purify, purifying, refinish, sanitise, scour, scrub up, wipe away, wipe up, wrasse, absterge, blarneying, descanting, neatening, pureeing, purfling, purgations, purgings, puritanize, purlicuing, purring, purveying, refile, refiles and sanifying. To understand how would you translate the word Saaf karna - صاف کرنا in English, you can take help from words closely related to Saaf karna - صاف کرنا or it’s English translations. Some of these words can also be considered Saaf karna - صاف کرنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Saaf karna - صاف کرنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Saaf karna - صاف کرنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Saaf karna - صاف کرنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Saaf karna - صاف کرنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by saaf karna?
Meanings of saaf karna are clarify, cleanse, filter, garble, gut, illustrate, iron, lustrate, mop, wash, deaminate, deaminization, deaminize, defecate, desalination, purgation, purge, purging, purify, purifying, refinish, sanitise, scour, scrub up, wipe away, wipe up, wrasse, absterge, blarneying, descanting, neatening, pureeing, purfling, purgations, purgings, puritanize, purlicuing, purring, purveying, refile, refiles and sanifying
Whats the definition of saaf karna?
Definition of the saaf karna are
- make clear by removing impurities or solids, as by heating
- make clear and (more) comprehensible
- clean one's body or parts thereof, as by washing
- purge of an ideology, bad thoughts, or sins
- run or flow slowly, as in drops or in an unsteady stream
- device that removes something from whatever passes through it
- an electrical device that alters the frequency spectrum of signals passing through it
- pass through
- make false by mutilation or addition; as of a message or story
- a strong cord made from the intestines of sheep and used in surgery
- the part of the alimentary canal between the stomach and the anus
- remove the guts of
- empty completely; destroy the inside of
- a narrow channel or strait
- depict with an illustration
- clarify by giving an example of
- supply with illustrations
- home appliance consisting of a flat metal base that is heated and used to smooth cloth
- a golf club that has a relatively narrow metal head
- implement used to brand live stock
- a heavy ductile magnetic metallic element; is silver-white in pure form but readily rusts; used in construction and tools and armament; plays a role in the transport of oxygen by the blood
- press and smooth with a heated iron
- extremely robust
- make moist
- the flow of air that is driven backwards by an aircraft propeller
- clean with some chemical process
- the work of cleansing (usually with soap and water)
- any enterprise in which losses and gains cancel out
- a watercolor made by applying a series of monochrome washes one over the other
- a thin coat of water-base paint
- the dry bed of an intermittent stream (as at the bottom of a canyon)
- garments or white goods that can be cleaned by laundering
- the erosive process of washing away soil or gravel by water (as from a roadway)
- move by or as if by water
- form by erosion
- admit to testing or proof
- be capable of being washed
- to cleanse (itself or another animal) by licking
- cleanse (one's body) with soap and water
- remove by the application of water or other liquid and soap or some other cleaning agent
- apply a thin coating of paint, metal, etc., to
- cleanse with a cleaning agent, such as soap, and water
- separate dirt or gravel from (precious minerals)
- wash or flow against
- remove the amino radical (usually by hydrolysis) from an amino compound; to perform deamination
- removal of the amino radical from an amino acid or other amino compound
- remove the amino radical (usually by hydrolysis) from an amino compound; to perform deamination
- the removal of salt (especially from sea water)
- purging the body by the use of a cathartic to stimulate evacuation of the bowels
- the act of clearing yourself (or another) from some stigma or charge
- a ceremonial cleansing from defilement or uncleanness by the performance of appropriate rites
- eject the contents of the stomach through the mouth
- rinse, clean, or empty with a liquid
- an abrupt or sudden removal of a person or group from an organization or place
- the act of clearing yourself (or another) from some stigma or charge
- excrete or evacuate (someone's bowels or body)
- rid of impurities
- make pure or free from sin or guilt
- clear of a charge
- oust politically
- an act of removing by cleansing; ridding of sediment or other undesired elements
- the act of clearing yourself (or another) from some stigma or charge
- serving to purge or rid of sin
- an act of removing by cleansing; ridding of sediment or other undesired elements
- make pure or free from sin or guilt
- become clean or pure or free of guilt and sin
- acting like an antiseptic
- freeing from noxious matter
- serving to purge or rid of sin
- give a new surface
- make less offensive or more acceptable by removing objectionable features
- make sanitary by cleaning or sterilizing
- rub hard or scrub
- rinse, clean, or empty with a liquid
- clean with hard rubbing
- examine minutely
- a place that is scoured (especially by running water)
- wash thoroughly
- remove by wiping
- chiefly tropical marine fishes with fleshy lips and powerful teeth; usually brightly colored
- ایک آلہ جِس کے ذریعے کِسی مائع سے ٹھوس اشیا الگ کی جاتی ہیں
What is the synonym of saaf karna?
Synonym of word saaf karna are صاف کرنا, واضح کرنا, صاف شفاف کرنا, تشریح کرنا, وضاحت کرنا, دھونا, دھول, جھاڑنا, پاک کرنا, صافی
What are the idioms related to saaf karna?
Here are the idioms that are related to the word saaf karna.
- He does not cleanse himself of his sins who denies them
- A silver key can open an iron like
- Iron age
- Iron will
- Man of iron