Saltanat - سلطنت meanings in English
Saltanat - سلطنت meanings in English are empire, emprising, empair, aldermanship, aldermancy, sultanship, sultaness, emparadise, state, sovereignty, rule, realm, principality, imperium, government, dominion, kingdom, emprison Saltanat - سلطنت in English. More meanings of saltanat - سلطنت, it's definitions, example sentences, related words, idioms and quotations.
empire emprising empair aldermanship aldermancy sultanship sultaness emparadise state sovereignty rule realm principality imperium government dominion kingdom emprison
Saltanat - سلطنت Definitions
Please find 54 English and 1 Urdu definitions related to the word Saltanat - سلطنت.
- (noun) : an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- (noun) : a group of countries under a single authority
- (noun) : a monarchy with an emperor as head of state
- (noun) : the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- (noun) : a basic group of natural objects
- (noun) : a monarchy with a king or queen as head of state
- (noun) : the domain ruled by a king or queen
- (noun) : a country with a king as head of state
- (noun) : a domain in which something is dominant
- (noun) : the highest taxonomic group into which organisms are grouped; one of five biological categories: Monera or Protoctista or Plantae or Fungi or Animalia
- (noun) : something regarded as a normative example
- (verb) : decide on and make a declaration about
- (noun) : a rule or law concerning a natural phenomenon or the function of a complex system
- (noun) : a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- (noun) : measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- (noun) : a principle or condition that customarily governs behavior
- (noun) : (mathematics) a standard procedure for solving a class of mathematical problems
- (noun) : any one of a systematic body of regulations defining the way of life of members of a religious order
- (noun) : prescribed guide for conduct or action
- (noun) : directions that define the way a game or sport is to be conducted
- (noun) : (linguistics) a rule describing (or prescribing) a linguistic practice
- (noun) : the duration of a monarch's or government's power
- (noun) : dominance or power through legal authority
- (verb) : keep in check
- (verb) : have an affinity with; of signs of the zodiac
- (verb) : decide with authority
- (verb) : mark or draw with a ruler
- (verb) : exercise authority over; as of nations
- (noun) : a region marked off for administrative or other purposes
- (noun) : dominance or power through legal authority
- (noun) : one of the self-governing nations in the British Commonwealth
- (noun) : the study of government of states and other political units
- (noun) : the organization that is the governing authority of a political unit
- (noun) : (government) the system or form by which a community or other political unit is governed
- (noun) : the act of governing; exercising authority
- (noun) : the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- (noun) : supreme authority; absolute dominion
- (noun) : territory ruled by a prince
- (noun) : the domain ruled by a king or queen
- (noun) : a domain in which something is dominant
- (noun) : a knowledge domain that you are interested in or are communicating about
- (noun) : the authority of a state to govern another state
- (noun) : government free from external control
- (noun) : royal authority; the dominion of a monarch
- (noun) : the territory occupied by a nation
- (noun) : a politically organized body of people under a single government
- (verb) : put before
- (noun) : the federal department in the United States that sets and maintains foreign policies
- (noun) : the way something is with respect to its main attributes
- (noun) : the group of people comprising the government of a sovereign state
- (noun) : the territory occupied by one of the constituent administrative districts of a nation
- (noun) : a state of depression or agitation
- (noun) : (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- (verb) : indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
More words related to the meanings of Saltanat - سلطنت
More words from English related to Saltanat - سلطنت
View an extensive list of words below that are related to the meanings of the word Saltanat - سلطنت meanings in English in English.
accompanimentconditioneventstanceaccountaffectionmoodnarrativenatureparticularspositionpostureprospectqualityremarkreportsituationstatestatementstoryaffirmaverenunciatelimnnarratedeclaredelineatedemonstratedescribeprefigurereciterecountrehearserelatereputescrivetellescribingnarratingarticulatingdecorticatingdesiccatingelaqueateepitomizingexplicatingapparitioncontoureffigy emblemface ... figureguiseidealinementlikenessmakemannersemblancesimilitudeappearanceaspectdiagramfeatureformformationgestaltget upimagemakingmodemodelnumeralpatternshapevarietywayshape upamorphismappertainconcerndiocese districtmanorrapportseigniorytenureaffinityareabearingcircleconnectionholdingjurisdictionlocalitynexusprovinceregionrelationrelevancyterritoryzonezonuleparvenueterrineterraneterritterreityterritoriedbuilderjurisprudencekingdomkingshipmasonbricklayerdominiongovernmentrealmreignruleswayrajcannondutifulobligationsstatutecanonharplawordinanceregulationsystemlawslawklawkslawmlawndceremonialcustomtraditionceremonyformalityhabitudeinstituteordinationpracticeritualwontrit.ritualiseritzyrittersrittingrittsritualizesritziestconstitutionusageecstasyrapturethisaffaircircumstanceinstantlifepredicamentpresentpresent tensevitalitykeeplikingcasenounplighttrimconfigurationmoraltenorbehaviourcharacterchiccuttingdemeanourfashionfoundinggarbstylevoguemodiusmodussceattcriterionmaximbaseetiquette formulahabitmannersmethodestablished orderprinciplebailiwickempire mastershipministryadministrationauthoritygovernancepowerregimeregimentgovedictfiatjurisdicationlibertymandatesequesterbehestbiddingcommandcommandmentjudicial decreedirectiveimperiumnoticeorderumpireverdictwarrantwrithakamkaiserdomemphrensykingrulershipgovernessyreignsruleredruleringrulershipsgovernablenessrule mongerpresidentshipsovereigntystatehoodstatesmanshipdomaineuropeguardianshipwardshipgeneralglorymagnificencemajestydignityeleganceeminencegrandeurpompshanshawnseanillustriousnesspageantryimperialkinglymajesticroyaltyregalroyalroyaliseroyalisedroyalisesroyalistsmammonmoneyfortunelucremeansmoolahopulencepelfricheswealthduluthwealthinessrichensrichessedealthtenetmotmottoprinciplesprincipiationprinciplingramentpathwayportrichnessprincipalityemirshipcountrynationabsolutenessautarchyautocracyastronomygenrelineamentphysiquecodeprocedurereuledegreefitkettledrumopportunitypitchtimeturnwatchdominategovernlordmastercircarsircarsirkarsirkarsindependenceindependencyautonomiesautonymsautonomyreigning
Idioms related to the meaning of Saltanat - سلطنت
What are the meanings of Saltanat - سلطنت in English?
Meanings of the word Saltanat - سلطنت in English are empire, kingdom, rule, dominion, government, imperium, principality, realm, sovereignty, state, emparadise, sultaness, sultanship, aldermancy, aldermanship, empair, emprising and emprison. To understand how would you translate the word Saltanat - سلطنت in English, you can take help from words closely related to Saltanat - سلطنت or it’s English translations. Some of these words can also be considered Saltanat - سلطنت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Saltanat - سلطنت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Saltanat - سلطنت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Saltanat - سلطنت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Saltanat - سلطنت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by saltanat?
Meanings of saltanat are empire, kingdom, rule, dominion, government, imperium, principality, realm, sovereignty, state, emparadise, sultaness, sultanship, aldermancy, aldermanship, empair, emprising and emprison
Whats the definition of saltanat?
Definition of the saltanat are
- an eating apple that somewhat resembles a McIntosh; used as both an eating and a cooking apple
- a group of countries under a single authority
- a monarchy with an emperor as head of state
- the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- a basic group of natural objects
- a monarchy with a king or queen as head of state
- the domain ruled by a king or queen
- a country with a king as head of state
- a domain in which something is dominant
- the highest taxonomic group into which organisms are grouped; one of five biological categories: Monera or Protoctista or Plantae or Fungi or Animalia
- something regarded as a normative example
- decide on and make a declaration about
- a rule or law concerning a natural phenomenon or the function of a complex system
- a basic generalization that is accepted as true and that can be used as a basis for reasoning or conduct
- measuring stick consisting of a strip of wood or metal or plastic with a straight edge that is used for drawing straight lines and measuring lengths
- a principle or condition that customarily governs behavior
- (mathematics) a standard procedure for solving a class of mathematical problems
- any one of a systematic body of regulations defining the way of life of members of a religious order
- prescribed guide for conduct or action
- directions that define the way a game or sport is to be conducted
- (linguistics) a rule describing (or prescribing) a linguistic practice
- the duration of a monarch's or government's power
- dominance or power through legal authority
- keep in check
- have an affinity with; of signs of the zodiac
- decide with authority
- mark or draw with a ruler
- exercise authority over; as of nations
- a region marked off for administrative or other purposes
- dominance or power through legal authority
- one of the self-governing nations in the British Commonwealth
- the study of government of states and other political units
- the organization that is the governing authority of a political unit
- (government) the system or form by which a community or other political unit is governed
- the act of governing; exercising authority
- the domain ruled by an emperor or empress; the region over which imperial dominion is exercised
- supreme authority; absolute dominion
- territory ruled by a prince
- the domain ruled by a king or queen
- a domain in which something is dominant
- a knowledge domain that you are interested in or are communicating about
- the authority of a state to govern another state
- government free from external control
- royal authority; the dominion of a monarch
- the territory occupied by a nation
- a politically organized body of people under a single government
- put before
- the federal department in the United States that sets and maintains foreign policies
- the way something is with respect to its main attributes
- the group of people comprising the government of a sovereign state
- the territory occupied by one of the constituent administrative districts of a nation
- a state of depression or agitation
- (chemistry) the three traditional states of matter are solids (fixed shape and volume) and liquids (fixed volume and shaped by the container) and gases (filling the container)
- indicate through a symbol, formula, etc.
- بلوائیوں کے عائد کردہ ضابطے
What is the synonym of saltanat?
Synonym of word saltanat are حکومت, فرماں روائی, شہنشاہی, اختیار شاہی, راج ادھیکار, حکمرانی, ریاست, مملکت, سلطنت, قلمرو
What are the idioms related to saltanat?
Here are the idioms that are related to the word saltanat.
- It is easier to rule a kingdom than a family
- Men rule the world women rule men
- Petticoat government
- In a state of nature
- Many laws in a state are a bad sign