Ulta - الٹا meanings in English
Ulta - الٹا meanings in English are obversely, upside, upside down, inversed, inversing, inversions, inversive, invertedly, renverse, renversed, subversed, reversibly, reversely, opponent, awry, back, crooked, inversely, left, opposite, reverse, wrong, invertase, subverted Ulta - الٹا in English. More meanings of ulta - الٹا, it's definitions, example sentences, related words, idioms and quotations.
obversely upside upside down inversed inversing inversions inversive invertedly renverse renversed subversed reversibly reversely opponent awry back crooked inversely left opposite reverse wrong invertase subverted
Ulta - الٹا Definitions
Please find 91 English and 4 Urdu definitions related to the word Ulta - الٹا.
- (adverb) : away from the correct or expected course
- (adverb) : turned or twisted to one side
- (adjective satellite) : not functioning properly
- (adjective satellite) : turned or twisted toward one side
- (noun) : a support that you can lean against while sitting
- (noun) : the posterior part of a human (or animal) body from the neck to the end of the spine
- (noun) : the part of something that is furthest from the normal viewer
- (noun) : (football) a person who plays in the backfield
- (noun) : the side that goes last or is not normally seen
- (noun) : the series of vertebrae forming the axis of the skeleton and protecting the spinal cord
- (verb) : establish as valid or genuine
- (verb) : support financial backing for
- (verb) : be behind; approve of
- (verb) : be in back of
- (verb) : shift to a counterclockwise direction
- (verb) : strengthen by providing with a back or backing
- (verb) : travel backward
- (verb) : cause to travel backward
- (verb) : give support or one's approval to
- (verb) : place a bet on
- (adverb) : in or to or toward a past time
- (adverb) : at or to or toward the back or rear
- (adverb) : in repayment or retaliation
- (adverb) : in or to or toward a former location
- (adverb) : in or to or toward an original condition
- (noun) : (American football) the position of a player on a football team who is stationed behind the line of scrimmage
- (noun) : the part of a garment that covers the back of your body
- (adjective satellite) : located at or near the back of an animal
- (adjective) : related to or located at the back
- (adjective satellite) : of an earlier date
- (adverb) : in reply
- (noun) : the protective covering on the front, back, and spine of a book
- (noun) : the hand that is on the left side of the body
- (noun) : those who support varying degrees of social or political or economic change designed to promote the public welfare
- (noun) : location near or direction toward the left side; i.e. the side to the north when a person or object faces east
- (noun) : the piece of ground in the outfield on the catcher's left
- (adjective) : of or belonging to the political or intellectual left
- (adjective) : being or located on or directed toward the side of the body to the west when facing north
- (adverb) : toward or on the left; also used figuratively
- (adjective satellite) : not used up
- (noun) : a turn toward the side of the body that is on the north when the person is facing east
- (adjective satellite) : intended for the left hand
- (noun) : someone who offers opposition
- (adjective satellite) : characterized by active hostility
- (noun) : a relation of direct opposition
- (noun) : something inverted in sequence or character or effect
- (adjective) : of leaves etc; growing in pairs on either side of a stem
- (adjective satellite) : altogether different in nature or quality or significance
- (adjective satellite) : the other one of a complementary pair
- (adjective satellite) : being directly across from each other; facing
- (adjective satellite) : moving or facing away from each other
- (adjective satellite) : characterized by opposite extremes; completely opposed
- (adverb) : directly facing each other
- (noun) : a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- (adjective satellite) : not appropriate for a purpose or occasion
- (noun) : that which is contrary to the principles of justice or law
- (verb) : treat unjustly; do wrong to
- (adjective satellite) : used of the side of cloth or clothing intended to face inward
- (adjective satellite) : not in accord with established usage or procedure
- (adjective) : contrary to conscience or morality or law
- (adjective) : based on or acting or judging in error
- (adjective) : not correct; not in conformity with fact or truth
- (adjective satellite) : badly timed
- (adjective satellite) : not functioning properly
- (noun) : any harm or injury resulting from a violation of a legal right
- (adverb) : in an inaccurate manner
- (adjective satellite) : characterized by errors; not agreeing with a model or not following established rules
- (adjective satellite) : irregular in shape or outline
- (adjective satellite) : having the back and shoulders rounded; not erect
- (adjective) : having or marked by bends or angles; not straight or aligned
- (adverb) : in an inverse or contrary manner
- (noun) : an enzyme that catalyzes the hydrolysis of sucrose into glucose and fructose
- (noun) : a relation of direct opposition
- (verb) : rule against
- (verb) : change to the contrary
- (noun) : turning in the opposite direction
- (verb) : cancel officially
- (adjective satellite) : reversed (turned backward) in order or nature or effect
- (verb) : turn inside out or upside down
- (noun) : (American football) a running play in which a back running in one direction hands the ball to a back running in the opposite direction
- (noun) : the gears by which the motion of a machine can be reversed
- (noun) : the side of a coin or medal that does not bear the principal design
- (adjective satellite) : directed or moving toward the rear
- (adjective) : of the transmission gear causing backward movement in a motor vehicle
- (noun) : an unfortunate happening that hinders or impedes; something that is thwarting or frustrating
- (verb) : reverse the position, order, relation, or condition of
- (adverb) : in an opposite way; so as to be reversed
- (adverb) : in a reversible manner
- (noun) : the highest or uppermost side of anything
- (adjective satellite) : being in such a position that top and bottom are reversed
- (adverb) : in an inverted manner
- سِياسی بائيں بازُو سے مُتعلِّق
- ایسے افراد یا منظم جماعت جو ملک کے معاشرتی
- سیاسی یا اقتصادی ڈھانچے میں انقلابی تبدیلیوں کی حامی ہو
- حَقائق اور صَداقَت کے خِلاف
More words related to the meanings of Ulta - الٹا
More words from English related to Ulta - الٹا
View an extensive list of words below that are related to the meanings of the word Ulta - الٹا meanings in English in English.
abaftabsenceafterbackwardperafterwardsasternbackconsequentlyin backsubsequentlywithdrawnbehindhandrearmahindbackarebehindsrearmsrearousalhind quarterposteriorrearabducemisdirectmisguidemisleadbeguilebluffdepravewronglead astrayleading astraymislikingmisplayingabreastceaselesscontinuouscoequalequableequalequallyflat liketantamountadjoiningalikeconstantlycontinuallyequivalent even ... identicallevelnextoppositequitsstraightuniformup toequablyequalisedequalisersequalizedequalizersequalizesequalledequallingequalsleveredepanthousabsurdityabsurdhighflownknuckle headmeaninglessnonsensicalunmeaningnullibietyabusesgrievousnessgripeoppressioncrueltyheartlessnessinjusticetyrannyatrociousnessatrocitycrueltiesoppilationoppressestyrannesstyranniestyrannisesantrustionoffensionacidblundererrorfalling fault fiascofourguiltmisconceitmisgivingomissionparkagoraneglectquadrivialsquarevenial sinyardchocsquarkquartesquareschoakacrossbiassidewaysslopwisetransversetransverselybentcrookedhandspikeinclinedobliqueslantingawrystickyathwartchurlishknock kneeroughrudeuncouthedge wise obliquelyskewslopinglyaskewcantedwryitalicsagainstcontracontradictoryopponentversuscontraryin opposition toagainstandcontrarietyfrowardnessobduracyobduratenessopinionativenesswaywardnessantilogyantithesiscontrarinessdournesseffronteryenmityinflexibilityinverseobstinacyoppositionpersistencepertinacityantitheticantitumorantitussivestub outstubbinessanticousantistaticantitheiststubbierstubbieststubblesstubblierstubblieststubbornedstubbornsanticontagiousantitropousstibbornstubbednessavertcontradictdabdistractveerpolishrejectreturnreversespinstroketrollturntwisttavertcross graineddifficultcrosscrotchetycurvedflaggingindirectperverseeccentricaberrantentrancemarketbacksbuttocksbreechdescentgenerationloinpatronpropsupportbadnessfaultinessimmoralitymischiefopprobriousnessvicewrongdoingsevilmalfeasancemalignancyviciousnessbank notepicknickpicnicravagebootydepredationdespoliationfleecingmarauderpillageplunderrapinerobberyrollingspoilwallowinglotteluthbastardyforbiddenillegalnefarioustabooadulterousadulteryillegitimateunlawfulwickedforbareforblackforbruiseblowbruisecouphurtjeerjestabusebaleconcussioncontusiondint hitinjuryinvectivenuisancequirksarcasmscathescofftaunttraumawisecrackwoundbruisinginjuriousnessbruitingbrumebrutesbrutifiedchottinjucunditymisserrmisstepmistakeslitherillaqueatingerreminisecrimefobilemisadventuremisapprehensionmisdeedmisdoingsinbevuedelictfallacyiniquitylapseoversightsliptransgressioncompensationcounter buffoverturnflightrequitalretaliationretreatrevengerevertrevolutionslewthrow backvolte faceconversely oppositelyabout faceantipodalcontrasto the contrarycontraindicatednayobverselyconvertaltercome backinvertreboundrecederecoilretirereverberaterevolvetoppleturn backturnoverwendpulletflimpsflinchingunplumbingunplumingflippantnessleftdissimilar enemy hostileobjectoroppugnantvariousadversaryadverseanticonfrontationaldissenterinimicalopposedvillainadversativeantagonistantagonisticanticanceropposableopposeradverserantlikeopposelessoppositesadversariousantagonisticalantagonizedanticorobversantoppositionistoppositipetalousconversionplittcompetitoremulousjeerermatchrivalviercontestantnemesisrivalrouspredialrivalessrivalisedrivalizedrivalledrivallessrivuletsbivalvousrivosecomparablecontendercollateralcopecoupsoversetoverthrowdenyremovetiptransposeupsetkeelsgermmalefactionfelonyoffencedelinquencyoffensenin sinsiniticsinssinchsinologuesinoplesinuositiescrisptortiletortuoustwistedvolutecurvateddandyfashion mongerfopgallantniftybeaucunningfoppishjauntyraffrakishslydamagedilapidation disservice encumbrances hurtfulnesshurtlessdeficitdestructiondetrimentharmhavoclosswastagewasteincurvationdamnationsdamnifiesdetrudesdowncomeharmineoncomedamnificationdisobedientdivergent infringeroddsquintvariantdefiantdevisordevourerenthralledwedgedcoshereddefatteddefieddeflecteddefrockeddeviateddevisabledevoiceddevoirsdisfrockeddisjecteddisrobedcolliquateddeductivelyegregiouserroneousimpropermisdelusionalfallowflawedinaccurateincorrectmistakenundueunfairwrongfulamissfauxfoul outimpreciselymalposedmiscuemisestimatemismatederrederumpentmisaimmisaimedmisalignedmisalliedmiscalledmiscuedmiscuingmisdatedmisdialmisdidmiseremiseresmisesmisfittedmisformedmisintendmiskeyedmispleasedmisquotedmisratedmisratesmisratingmisseemistedmisteredmistiermistimedmiswentperjuriousperjurouswrongingwrongouseversefalwemiskenmisrendermisrepeatmisseekmiswedmisyuncorrectfeloniousfoefiendfoemanfoemenfoeseneidmatchableconversematchingplausiveobvolutedversalcompunctiousheremiticaloblocutorewer foregoingprecedentforegonefriendshipintimacypreviousantecedenceantecedencyanteriorityprefixantecessorantevertantetempleexcedentretrocedentforlorn obsoleteoutdatedabandonedderelictdisusedforsakenlornobsolescentomittedrejectedrelinquishedobsequialobsolescedobsoletelyforwardyonderafrontaheadbeforefacing in frontfrontallyout frontfrontagesfaciendkeckvomittingvomitervomitingvomitivevomitoryvomitusinvertsvomitedvomitingsvomitovomitsvomitusesinvertebratedvomitionleeward sideleftwardlyleftwardleftwardsmistakenlyinvertedyonprosecutoraccuserclaimantcomplainantlitigantplaintiffplainchantplaintiveplaintiffsplainantface to facevis a visoppositiveinexactretrogradereversalreversionreversreversedreversiveultinversesobversesoverturnsreversalsreversedlyreversesreversingreversingsreversisreverselessclashconflictconflictingcontradictiondiscordantinconsequentcounteragainreturnedreturningrerewardcrankydeformeddispleasedinflexedirregularobstinateoffendedopposingbudchumclose friendpalpartneryokefellowdamageddistortedbelowposternpinespayencomplicatedmeanderingcounterpartimagephotographreflectiondiagonallykedgerepeltopsyturvyupside down
Idioms related to the meaning of Ulta - الٹا
What are the meanings of Ulta - الٹا in English?
Meanings of the word Ulta - الٹا in English are awry, back, left, obversely, opponent, opposite, wrong, crooked, inversely, invertase, reverse, reversely, reversibly, upside, upside down, inversed, inversing, inversions, inversive, invertedly, renverse, renversed, subversed and subverted. To understand how would you translate the word Ulta - الٹا in English, you can take help from words closely related to Ulta - الٹا or it’s English translations. Some of these words can also be considered Ulta - الٹا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Ulta - الٹا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Ulta - الٹا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Ulta - الٹا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Ulta - الٹا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ulta?
Meanings of ulta are awry, back, left, obversely, opponent, opposite, wrong, crooked, inversely, invertase, reverse, reversely, reversibly, upside, upside down, inversed, inversing, inversions, inversive, invertedly, renverse, renversed, subversed and subverted
Whats the definition of ulta?
Definition of the ulta are
- away from the correct or expected course
- turned or twisted to one side
- not functioning properly
- turned or twisted toward one side
- a support that you can lean against while sitting
- the posterior part of a human (or animal) body from the neck to the end of the spine
- the part of something that is furthest from the normal viewer
- (football) a person who plays in the backfield
- the side that goes last or is not normally seen
- the series of vertebrae forming the axis of the skeleton and protecting the spinal cord
- establish as valid or genuine
- support financial backing for
- be behind; approve of
- be in back of
- shift to a counterclockwise direction
- strengthen by providing with a back or backing
- travel backward
- cause to travel backward
- give support or one's approval to
- place a bet on
- in or to or toward a past time
- at or to or toward the back or rear
- in repayment or retaliation
- in or to or toward a former location
- in or to or toward an original condition
- (American football) the position of a player on a football team who is stationed behind the line of scrimmage
- the part of a garment that covers the back of your body
- located at or near the back of an animal
- related to or located at the back
- of an earlier date
- in reply
- the protective covering on the front, back, and spine of a book
- the hand that is on the left side of the body
- those who support varying degrees of social or political or economic change designed to promote the public welfare
- location near or direction toward the left side; i.e. the side to the north when a person or object faces east
- the piece of ground in the outfield on the catcher's left
- of or belonging to the political or intellectual left
- being or located on or directed toward the side of the body to the west when facing north
- toward or on the left; also used figuratively
- not used up
- a turn toward the side of the body that is on the north when the person is facing east
- intended for the left hand
- someone who offers opposition
- characterized by active hostility
- a relation of direct opposition
- something inverted in sequence or character or effect
- of leaves etc; growing in pairs on either side of a stem
- altogether different in nature or quality or significance
- the other one of a complementary pair
- being directly across from each other; facing
- moving or facing away from each other
- characterized by opposite extremes; completely opposed
- directly facing each other
- a word that expresses a meaning opposed to the meaning of another word, in which case the two words are antonyms of each other
- not appropriate for a purpose or occasion
- that which is contrary to the principles of justice or law
- treat unjustly; do wrong to
- used of the side of cloth or clothing intended to face inward
- not in accord with established usage or procedure
- contrary to conscience or morality or law
- based on or acting or judging in error
- not correct; not in conformity with fact or truth
- badly timed
- not functioning properly
- any harm or injury resulting from a violation of a legal right
- in an inaccurate manner
- characterized by errors; not agreeing with a model or not following established rules
- irregular in shape or outline
- having the back and shoulders rounded; not erect
- having or marked by bends or angles; not straight or aligned
- in an inverse or contrary manner
- an enzyme that catalyzes the hydrolysis of sucrose into glucose and fructose
- a relation of direct opposition
- rule against
- change to the contrary
- turning in the opposite direction
- cancel officially
- reversed (turned backward) in order or nature or effect
- turn inside out or upside down
- (American football) a running play in which a back running in one direction hands the ball to a back running in the opposite direction
- the gears by which the motion of a machine can be reversed
- the side of a coin or medal that does not bear the principal design
- directed or moving toward the rear
- of the transmission gear causing backward movement in a motor vehicle
- an unfortunate happening that hinders or impedes; something that is thwarting or frustrating
- reverse the position, order, relation, or condition of
- in an opposite way; so as to be reversed
- in a reversible manner
- the highest or uppermost side of anything
- being in such a position that top and bottom are reversed
- in an inverted manner
- سِياسی بائيں بازُو سے مُتعلِّق
- ایسے افراد یا منظم جماعت جو ملک کے معاشرتی
- سیاسی یا اقتصادی ڈھانچے میں انقلابی تبدیلیوں کی حامی ہو
- حَقائق اور صَداقَت کے خِلاف
What is the synonym of ulta?
Synonym of word ulta are بینڈا, ترچھا, ٹیڑھا, کج, کج رو, اُریبواں, بل دار, منحرف, غلط, الٹا
What are the idioms related to ulta?
Here are the idioms that are related to the word ulta.
- A crooked stick has a crooked shadow
- Upside down
- Upside down
- Be opposite with
- Every medal has its reverse side