Dornay - دوڑنے meanings in English
Dornay - دوڑنے meanings in English is step Dornay - دوڑنے in English. More meanings of dornay - دوڑنے, it's definitions, example sentences, related words, idioms and quotations.
Dornay - دوڑنے Definitions
Please find 18 English and 1 Urdu definitions related to the word Dornay - دوڑنے.
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words from English related to Dornay - دوڑنے
View an extensive list of words below that are related to the meanings of the word Dornay - دوڑنے meanings in English in English.
ceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcruxdifficultyinnjourneylegstageemblem ... markmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentfootfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsfoot pacefootfallfootstepmeasurepacestridesteedsstetsyardp.a.pasuppressionmeasuresInitiatives
Idioms with the word Dornay - دوڑنے in it
Idioms related to the meaning of Dornay - دوڑنے
What are the meanings of Dornay - دوڑنے in English?
Meanings of the word Dornay - دوڑنے in English is step. To understand how would you translate the word Dornay - دوڑنے in English, you can take help from words closely related to Dornay - دوڑنے or it’s English translations. Some of these words can also be considered Dornay - دوڑنے synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Dornay - دوڑنے. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Dornay - دوڑنے in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Dornay - دوڑنے in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Dornay - دوڑنے with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by دوڑنے?
Meaning of دوڑنے is step
Whats the definition of دوڑنے?
Definition of the دوڑنے are
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of دوڑنے?
Synonym of word دوڑنے are چال, مرحلہ, نقش, پاؤں, قدم, پا, ڈگ, اقدام, تال پر ناچنا, سکیل کا کوئی ایک درجہ
What are the idioms with the word دوڑنے?
Here are the idioms with the word دوڑنے in them.
- Creep before you gang
- What is the use of running when you are on the wrong road
What are the idioms related to دوڑنے?
Here are the idioms that are related to the word دوڑنے.
- Step after step the ladder is ascended
- Step by step one goes far
- A journey of a thousand miles begins with one step
- Be in step into one or dead
- If you tell every step you will make a long journey