بھاپ ہو جانا meanings in English
بھاپ ہو جانا Definitions
Please find 6 English and definitions related to the word بھاپ ہو جانا.
- (verb) : become less intense and fade away gradually
- (verb) : lose or cause to lose liquid by vaporization leaving a more concentrated residue
- (verb) : change into a vapor
- (verb) : cause to change into a vapor
- (noun) : a visible suspension in the air of particles of some substance
- (noun) : the process of becoming a vapor
More words related to the meanings of بھاپ ہو جانا
More words from English related to بھاپ ہو جانا
View an extensive list of words below that are related to the meanings of the word بھاپ ہو جانا meanings in English in English.
camphorvapourdisappearevaporateevanesceclear outdecampfleevapourisegageimportunejibleapobstructwaftwageflypersistblow flyfleawortfling offflyblownfleyingfliersflingingfliskingflockingflypeflypingflyteflytingflywheelsdriftpiecedriftwindfleenfleetenfly catchingfumesteamreekrokesteaminesssteamiessteamingssteamssteamshipssteamtightevaporableevaporatedevaporative ... evaporiteevaporometervaporificvaporingvaporisationvaporisevaporiservaporishvaporizationvaporizedvaporousnessvaporsvapourisedvapourishvapourousvapourousnessvapoursevaporatesevaporatorvaporedvaporiformvaporisedvaporisersvaporisesvaporisingvaporizersvaporizesvaporosityvaporwarevapouringsvapulatevapulatedvapulatesvapulatingevaporaivevaporabilityvaporatevaporationvaporiferousmistinesspinfoghazemistfog upfoggedfogginessfoggagefoggagesfogiesfoglefoglesfogmenfogramfogramityfogsfogydomshogfog'gage
Idioms with the word بھاپ ہو جانا in it
What are the meanings of بھاپ ہو جانا in English?
Meanings of the word بھاپ ہو جانا in English are evaporate and vapour. To understand how would you translate the word بھاپ ہو جانا in English, you can take help from words closely related to بھاپ ہو جانا or it’s English translations. Some of these words can also be considered بھاپ ہو جانا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word بھاپ ہو جانا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use بھاپ ہو جانا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say بھاپ ہو جانا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of بھاپ ہو جانا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by بھاپ ہو جانا?
Meanings of بھاپ ہو جانا are evaporate and vapour
Whats the definition of بھاپ ہو جانا?
Definition of the بھاپ ہو جانا are
- become less intense and fade away gradually
- lose or cause to lose liquid by vaporization leaving a more concentrated residue
- change into a vapor
- cause to change into a vapor
- a visible suspension in the air of particles of some substance
- the process of becoming a vapor
What is the synonym of بھاپ ہو جانا?
Synonym of word بھاپ ہو جانا are بھاپ ہو جانا, بخار بن کر اڑ جانا, اڑنا, ابخرے اٹھنا, بُخارات بن جانا, بُخارات بن کر اُڑ جانا, غائب ہو جانا, رطوبت خارج کرنا, ہوا ہونا, بخار بن کے اڑنا
What are the idioms with the word بھاپ ہو جانا?
Here are the idioms with the word بھاپ ہو جانا in them.
- Jog away jog off
- Fall off
- Go back
- Go under
- Keep good hour