machhli pakarna - مچھلی پکڑنا meanings in English
machhli pakarna - مچھلی پکڑنا meanings in English are fish, piscicapture machhli pakarna - مچھلی پکڑنا in English. More meanings of machhli pakarna - مچھلی پکڑنا, it's definitions, example sentences, related words, idioms and quotations.
machhli pakarna - مچھلی پکڑنا Definitions
Please find 7 English and definitions related to the word machhli pakarna - مچھلی پکڑنا.
- (noun) : any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- (noun) : the flesh of fish used as food
- (noun) : (astrology) a person who is born while the sun is in Pisces
- (noun) : the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- (verb) : catch or try to catch fish or shellfish
- (verb) : seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
More words related to the meanings of machhli pakarna - مچھلی پکڑنا
More words from English related to machhli pakarna - مچھلی پکڑنا
View an extensive list of words below that are related to the meanings of the word machhli pakarna - مچھلی پکڑنا meanings in English in English.
fishmusclealligator pearalligatorfishcrampfishfiscfisheyefishwifelobe finned fishmay fishpiscatorypiscinestill fishsweetbriarbeeswingcramponscrocketscrocoisitecubsfiscalsfiscsfishablefishedfishinessfisksfistianamishmashespiscariespisciformpiskiespissoirssweetfishbearishnesscich peafleshquakefriesishpiscationpiscinalpiscesmainejack tar
Idioms with the word machhli pakarna - مچھلی پکڑنا in it
Idioms related to the meaning of machhli pakarna - مچھلی پکڑنا
What are the meanings of machhli pakarna - مچھلی پکڑنا in English?
Meanings of the word machhli pakarna - مچھلی پکڑنا in English are fish and piscicapture. To understand how would you translate the word machhli pakarna - مچھلی پکڑنا in English, you can take help from words closely related to machhli pakarna - مچھلی پکڑنا or it’s English translations. Some of these words can also be considered machhli pakarna - مچھلی پکڑنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word machhli pakarna - مچھلی پکڑنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use machhli pakarna - مچھلی پکڑنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say machhli pakarna - مچھلی پکڑنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of machhli pakarna - مچھلی پکڑنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by مچھلی پکڑنا?
Meanings of مچھلی پکڑنا are fish and piscicapture
Whats the definition of مچھلی پکڑنا?
Definition of the مچھلی پکڑنا are
- any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- the flesh of fish used as food
- (astrology) a person who is born while the sun is in Pisces
- the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- catch or try to catch fish or shellfish
- seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
What is the synonym of مچھلی پکڑنا?
Synonym of word مچھلی پکڑنا are بنسی کھیلنا, مچھلی کا شکار کرنا, ڈگن مارنا, مچھلی, مچھی, مین, متس, ماہی, جل تری, مچھلی کا گوشت
What are the idioms with the word مچھلی پکڑنا?
Here are the idioms with the word مچھلی پکڑنا in them.
- Give a clown your finger and he will take your whole hand
- Law put cast salt on one tail
- Law put cast salt on ones tail
- Strike root
- Take shape
What are the idioms related to مچھلی پکڑنا?
Here are the idioms that are related to the word مچھلی پکڑنا.
- A fish out of water
- All fish are not caught with flies
- All is fish that comes to his net
- Better small fish than an empty dish
- Daughters and dead fish are not keeping wares