مچھلی کا گوشت meanings in English
مچھلی کا گوشت meanings in English is fish مچھلی کا گوشت in English. More meanings of مچھلی کا گوشت, it's definitions, example sentences, related words, idioms and quotations.
مچھلی کا گوشت Definitions
Please find 7 English and definitions related to the word مچھلی کا گوشت.
- (noun) : any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- (noun) : the flesh of fish used as food
- (noun) : (astrology) a person who is born while the sun is in Pisces
- (noun) : the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- (verb) : catch or try to catch fish or shellfish
- (verb) : seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
More words related to the meanings of مچھلی کا گوشت
Fish | بنسی کھیلنا مچھلی کا شکار کرنا ڈگن مارنا مچھلی machhli مچھلی machli مچھی مین Meen متس Matas ماہی maahi ماہی Mahi جل تری مچھلی کا گوشت ماس مچھلی مچھلی پکڑنا machhli pakarna |
More words from English related to مچھلی کا گوشت
View an extensive list of words below that are related to the meanings of the word مچھلی کا گوشت meanings in English in English.
fishmusclealligator pearalligatorfishcrampfishfiscfisheyefishwifelobe finned fishmay fishpiscatorypiscinestill fishsweetbriarbeeswingcramponscrocketscrocoisitecubsfiscalsfiscsfishablefishedfishinessfisksfistianamishmashespiscariespisciformpiskiespissoirssweetfishbearishnesscich peafleshquakefriesishpiscationpiscinalpiscesmainejack tarpiscicapture
Idioms with the word مچھلی کا گوشت in it
Idioms related to the meaning of مچھلی کا گوشت
What are the meanings of مچھلی کا گوشت in English?
Meanings of the word مچھلی کا گوشت in English is fish. To understand how would you translate the word مچھلی کا گوشت in English, you can take help from words closely related to مچھلی کا گوشت or it’s English translations. Some of these words can also be considered مچھلی کا گوشت synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word مچھلی کا گوشت. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use مچھلی کا گوشت in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say مچھلی کا گوشت in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of مچھلی کا گوشت with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by مچھلی کا گوشت?
Meaning of مچھلی کا گوشت is fish
Whats the definition of مچھلی کا گوشت?
Definition of the مچھلی کا گوشت are
- any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills
- the flesh of fish used as food
- (astrology) a person who is born while the sun is in Pisces
- the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
- catch or try to catch fish or shellfish
- seek indirectly
- has been an important source of protein for humans throughout recorded history. Fish is traditionally cooked in a saalan curry or fried with masala spices.
What is the synonym of مچھلی کا گوشت?
Synonym of word مچھلی کا گوشت are بنسی کھیلنا, مچھلی کا شکار کرنا, ڈگن مارنا, مچھلی, مچھی, مین, متس, ماہی, جل تری, مچھلی کا گوشت
What are the idioms with the word مچھلی کا گوشت?
Here are the idioms with the word مچھلی کا گوشت in them.
- Young flesh and old are best
- Pope nose
- Popes nose
- Take heed of enemies reconciled and of meat twice boiled
- The nearer the bone the sweeter the flesh
What are the idioms related to مچھلی کا گوشت?
Here are the idioms that are related to the word مچھلی کا گوشت.
- A fish out of water
- All fish are not caught with flies
- All is fish that comes to his net
- Better small fish than an empty dish
- Daughters and dead fish are not keeping wares