Chadi - چھڑی meanings in English
Chadi - چھڑی meanings in English are cane, canticoy, reedings, rodding, roding, rods, roks, roods, stickjaw, stickjaws, wands, walkingstick, stickweed, walker staff, wand, baton, rod, walking stick, wattle, canicule, canticle, paroquet, stickpin, parquetage Chadi - چھڑی in English. More meanings of chadi - چھڑی, it's definitions, example sentences, related words, idioms and quotations.
cane canticoy reedings rodding roding rods roks roods stickjaw stickjaws wands walkingstick stickweed walker staff wand baton rod walking stick wattle canicule canticle paroquet stickpin parquetage
Chadi - چھڑی Definitions
Please find 30 English and 1 Urdu definitions related to the word Chadi - چھڑی.
- (noun) : a stiff switch used to hit students as punishment
- (noun) : a stick that people can lean on to help them walk
- (noun) : a strong slender often flexible stem as of bamboos, reeds, rattans, or sugar cane
- (verb) : beat with a cane
- (noun) : a gangster's pistol
- (noun) : a square rod of land
- (noun) : a linear measure of 16.5 feet
- (noun) : any rod-shaped bacterium
- (noun) : a long thin implement made of metal or wood
- (noun) : a visual receptor cell that is sensitive to dim light
- (noun) : a thin tapered rod used by a conductor to lead an orchestra or choir
- (noun) : a rod used by a magician or water diviner
- (noun) : a thin supple twig or rod
- (noun) : framework consisting of stakes interwoven with branches to form a fence
- (noun) : a fleshy wrinkled and often brightly colored fold of skin hanging from the neck or throat of certain birds (chickens and turkeys) or lizards
- (verb) : interlace to form wattle
- (verb) : build of or with wattle
- (noun) : any of various Australasian trees yielding slender poles suitable for wattle
- (noun) : a thin tapered rod used by a conductor to lead an orchestra or choir
- (noun) : a hollow cylinder passed from runner to runner in a relay race
- (noun) : a hollow metal rod that is wielded or twirled by a drum major or drum majorette
- (noun) : a short staff carried by some officials to symbolize an office or an authority
- (noun) : a short stout club used primarily by policemen
- (noun) : the hot period between early July and early September; a period of inactivity
- (noun) : a hymn derived from the Bible
- (noun) : a decorative pin that is worn in a necktie
- (noun) : any of several herbaceous plants having seeds that cling to clothing
- (noun) : any of various mostly tropical insects having long twiglike bodies
- (noun) : a stick carried in the hand for support in walking
- (noun) : any of various mostly tropical insects having long twiglike bodies
- دھات يا مُختَلِف مادّوں سے بَنی ہُوئی چھَڑی يا سُلاخ
More words related to the meanings of Chadi - چھڑی
More words from English related to Chadi - چھڑی
View an extensive list of words below that are related to the meanings of the word Chadi - چھڑی meanings in English in English.
bludgeonleverbatclubcudgelquarterstaffrodtruncheonbingerstingraystegcanewalker staffgoadstaffvergemacesceptresticklathistick lacbatonsstavesstickingsstickshornramustinewattleboughbranchcornuoffshootsectionspraystalestalkbrankknitbecomegathergetpluckpretendselectshamstitchswankweavebecomingness ... knishknitworkknitchesknittlehandlelugquillstemdandiosierphysicianrattanwickerwillowyardtwiglocustaetwiggentwiggerlumberwoodfirewoodhardwoodlacrimationlightwoodparquetrytimbreunwoodedwood ibiswoodbinewoodborerwoodcarvingwoodcraftwoodennesswoodgrainwoodhewerwoodinesswoodruffwoodwindlitteryscribblestimberingtimberingswoodbineswoodcockswoodingwoodlicewoodnesswoodshedswoodwosewoodwoseswood sarewood serewoodmeilwandtattabaton
Idioms related to the meaning of Chadi - چھڑی
What are the meanings of Chadi - چھڑی in English?
Meanings of the word Chadi - چھڑی in English are cane, rod, walker staff, wand, wattle, baton, canicule, canticle, paroquet, stickpin, stickweed, walking stick, walkingstick, canticoy, reedings, rodding, roding, rods, roks, roods, stickjaw, stickjaws, wands and parquetage. To understand how would you translate the word Chadi - چھڑی in English, you can take help from words closely related to Chadi - چھڑی or it’s English translations. Some of these words can also be considered Chadi - چھڑی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Chadi - چھڑی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Chadi - چھڑی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Chadi - چھڑی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Chadi - چھڑی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by chadi?
Meanings of chadi are cane, rod, walker staff, wand, wattle, baton, canicule, canticle, paroquet, stickpin, stickweed, walking stick, walkingstick, canticoy, reedings, rodding, roding, rods, roks, roods, stickjaw, stickjaws, wands and parquetage
Whats the definition of chadi?
Definition of the chadi are
- a stiff switch used to hit students as punishment
- a stick that people can lean on to help them walk
- a strong slender often flexible stem as of bamboos, reeds, rattans, or sugar cane
- beat with a cane
- a gangster's pistol
- a square rod of land
- a linear measure of 16.5 feet
- any rod-shaped bacterium
- a long thin implement made of metal or wood
- a visual receptor cell that is sensitive to dim light
- a thin tapered rod used by a conductor to lead an orchestra or choir
- a rod used by a magician or water diviner
- a thin supple twig or rod
- framework consisting of stakes interwoven with branches to form a fence
- a fleshy wrinkled and often brightly colored fold of skin hanging from the neck or throat of certain birds (chickens and turkeys) or lizards
- interlace to form wattle
- build of or with wattle
- any of various Australasian trees yielding slender poles suitable for wattle
- a thin tapered rod used by a conductor to lead an orchestra or choir
- a hollow cylinder passed from runner to runner in a relay race
- a hollow metal rod that is wielded or twirled by a drum major or drum majorette
- a short staff carried by some officials to symbolize an office or an authority
- a short stout club used primarily by policemen
- the hot period between early July and early September; a period of inactivity
- a hymn derived from the Bible
- a decorative pin that is worn in a necktie
- any of several herbaceous plants having seeds that cling to clothing
- any of various mostly tropical insects having long twiglike bodies
- a stick carried in the hand for support in walking
- any of various mostly tropical insects having long twiglike bodies
- دھات يا مُختَلِف مادّوں سے بَنی ہُوئی چھَڑی يا سُلاخ
What is the synonym of chadi?
Synonym of word chadi are چھڑی, جریب, عصا, لاٹھی, ڈَنڈا, عصّا, لَکڑی, ڈنڈا, ڈنڈی, چوب دستی
What are the idioms related to chadi?
Here are the idioms that are related to the word chadi.
- A nod to the wise and a rod to the foolish
- Kiss the rod
- Make something a rod for one back
- Rod in pickle
- Rod tames everyone