tamiil - تعمیل meanings in English
tamiil - تعمیل meanings in English are function, operation, act on, implementation, complied, complies, discompliance tamiil - تعمیل in English. More meanings of tamiil - تعمیل, it's definitions, example sentences, related words, idioms and quotations.
function operation act on implementation complied complies discompliance
tamiil - تعمیل Definitions
Please find 24 English and definitions related to the word tamiil - تعمیل.
- (noun) : the actions and activities assigned to or required or expected of a person or group
- (noun) : what something is used for
- (noun) : a formal or official social gathering or ceremony
- (noun) : a relation such that one thing is dependent on another
- (noun) : a vaguely specified social event
- (verb) : perform as expected when applied
- (verb) : serve a purpose, role, or function
- (verb) : perform duties attached to a particular office or place or function
- (noun) : (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- (noun) : the act of implementing (providing a practical means for accomplishing something); carrying into effect
- (noun) : the act of accomplishing some aim or executing some order
- (noun) : the activity of operating something (a machine or business etc.)
- (noun) : a planned activity involving many people performing various actions
- (noun) : a process or series of acts especially of a practical or mechanical nature involved in a particular form of work
- (noun) : a medical procedure involving an incision with instruments; performed to repair damage or arrest disease in a living body
- (noun) : activity by a military or naval force (as a maneuver or campaign)
- (noun) : a business especially one run on a large scale
- (noun) : (computer science) data processing in which the result is completely specified by a rule (especially the processing that results from a single instruction)
- (noun) : process or manner of functioning or operating
- (noun) : the state of being in effect or being operative
- (noun) : (mathematics) calculation by mathematical methods
- (noun) : (psychology) the performance of some composite cognitive activity; an operation that affects mental contents
- (verb) : carry further or advance
- (verb) : regulate one's behavior in accordance with certain information, ideas, or advice
More words related to the meanings of tamiil - تعمیل
More words from English related to tamiil - تعمیل
View an extensive list of words below that are related to the meanings of the word tamiil - تعمیل meanings in English in English.
absolutenessaccomplishmentcomplementconsummationcompletionfulnessimplementationmaturityachievementfinalisationintegrationcomplementaritycomplementationfulfillmentsupplementationcompleatcompletivefinishingsfulminatessuppletionaccomplicitycompellationcompletementcomplotmentendurementexpediteactactionarduouscallingjoblustmakingmanufactureploytendvalueworkbusinessdesigndesireembroideryemploymentengagementerrand functionintentionlabourmetierobject ... occupationpurporttaskundertakinguseworkmanshipchoreskamcom werkoperationconscienceenemamotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitfeatgestmeasurenounpracticeprocedureprocessworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresactiveverbpretencepretextverbenaverbosenessverbalsverberatesverbidverbidsverbsverismchargejurisdicationoccupancyprerogativechorenecessityobligatoryobligationsdivine ordinancedutyon handincumbentincumbencyindispensablemoral obligationresponsibilitystatutesuppositionassuetudesassumpsitassuefactionsupposurechiefoptionpicksupersedeabbreviationadoptionauthoritychoicecontroldiscretionimprimaturjurisdictionpowerpossessivenessauthorismobreptionemployministrationofficeserviceserve upservicingservicedservageserviceageefficiencymustercollectingprovisionsupplydeliverableimpartationsupplyingdeliverlysuppedsuppliancedeliberdelirancydelivernessprovisionedprovisioningprovostshiptransactionpittanceappanagegrantpensionreligious broodingstipendvocationstipelstipellatestipelsstipendsstipitesstipendiariesstipendiatestipitiformstipulaeact onmoveongoingproceeding
Idioms related to the meaning of tamiil - تعمیل
What are the meanings of tamiil - تعمیل in English?
Meanings of the word tamiil - تعمیل in English are function, implementation, operation, act on, complied, complies and discompliance. To understand how would you translate the word tamiil - تعمیل in English, you can take help from words closely related to tamiil - تعمیل or it’s English translations. Some of these words can also be considered tamiil - تعمیل synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word tamiil - تعمیل. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use tamiil - تعمیل in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say tamiil - تعمیل in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of tamiil - تعمیل with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by تعمیل?
Meanings of تعمیل are function, implementation, operation, act on, complied, complies and discompliance
Whats the definition of تعمیل?
Definition of the تعمیل are
- the actions and activities assigned to or required or expected of a person or group
- what something is used for
- a formal or official social gathering or ceremony
- a relation such that one thing is dependent on another
- a vaguely specified social event
- perform as expected when applied
- serve a purpose, role, or function
- perform duties attached to a particular office or place or function
- (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- the act of implementing (providing a practical means for accomplishing something); carrying into effect
- the act of accomplishing some aim or executing some order
- the activity of operating something (a machine or business etc.)
- a planned activity involving many people performing various actions
- a process or series of acts especially of a practical or mechanical nature involved in a particular form of work
- a medical procedure involving an incision with instruments; performed to repair damage or arrest disease in a living body
- activity by a military or naval force (as a maneuver or campaign)
- a business especially one run on a large scale
- (computer science) data processing in which the result is completely specified by a rule (especially the processing that results from a single instruction)
- process or manner of functioning or operating
- the state of being in effect or being operative
- (mathematics) calculation by mathematical methods
- (psychology) the performance of some composite cognitive activity; an operation that affects mental contents
- carry further or advance
- regulate one's behavior in accordance with certain information, ideas, or advice
What is the synonym of تعمیل?
Synonym of word تعمیل are کام, عمل, ادھکار, فرض, اختیار, خدمت, کار گزاری, تعمیل, وظیفہ, تکمیل
What are the idioms related to تعمیل?
Here are the idioms that are related to the word تعمیل.
- Combined operation
- To come into operation