kaam - کام meanings in English
kaam - کام meanings in English are act, errand, function, intention, labour, metier, object, occupation, purport, task, undertaking, use, workmanship, chores, kam, com, engagement, employment, action, arduous, calling, job, lust, making, manufacture, ploy, tend, value, work, business, design, desire, embroidery, werk kaam - کام in English. More meanings of kaam - کام, it's definitions, example sentences, related words, idioms and quotations.
act errand function intention labour metier object occupation purport task undertaking use workmanship chores kam com engagement employment action arduous calling job lust making manufacture ploy tend value work business design desire embroidery werk
kaam - کام Definitions
Please find 181 English and 4 Urdu definitions related to the word kaam - کام.
- (noun) : something that people do or cause to happen
- (noun) : a legal document codifying the result of deliberations of a committee or society or legislative body
- (noun) : a subdivision of a play or opera or ballet
- (noun) : a manifestation of insincerity
- (verb) : perform an action, or work out or perform (an action)
- (verb) : be engaged in an activity, often for no particular purpose other than pleasure
- (verb) : be suitable for theatrical performance
- (verb) : discharge one's duties
- (verb) : play a role or part
- (verb) : perform on a stage or theater
- (verb) : pretend to have certain qualities or state of mind
- (verb) : have an effect or outcome; often the one desired or expected
- (verb) : behave unnaturally or affectedly
- (noun) : a short performance that is part of a longer program
- (verb) : put in effect
- (noun) : something done (usually as opposed to something said)
- (noun) : the most important or interesting work or activity in a specific area or field
- (noun) : an act by a government body or supranational organization
- (noun) : the operating part that transmits power to a mechanism
- (noun) : the trait of being active and energetic and forceful
- (noun) : the series of events that form a plot
- (noun) : a military engagement
- (noun) : a judicial proceeding brought by one party against another; one party prosecutes another for a wrong done or for protection of a right or for prevention of a wrong
- (adjective satellite) : difficult to accomplish; demanding considerable mental effort and skill
- (adjective satellite) : taxing to the utmost; testing powers of endurance
- (adjective satellite) : characterized by effort to the point of exhaustion; especially physical effort
- (noun) : incidental activity performed by an actor for dramatic effect
- (noun) : a rightful concern or responsibility
- (noun) : an immediate objective
- (noun) : business concerns collectively
- (noun) : the activity of providing goods and services involving financial and commercial and industrial aspects
- (noun) : customers collectively
- (noun) : the volume of commercial activity
- (noun) : the particular occupation for which you are trained
- (noun) : the state of being employed or having a job
- (noun) : the occupation for which you are paid
- (noun) : the act of giving someone a job
- (noun) : the act of using
- (noun) : a meeting arranged in advance
- (noun) : the act of giving someone a job
- (noun) : employment for performers or performing groups that lasts for a limited period of time
- (noun) : the act of sharing in the activities of a group
- (noun) : contact by fitting together
- (noun) : a mutual promise to marry
- (noun) : the actions and activities assigned to or required or expected of a person or group
- (noun) : what something is used for
- (noun) : a formal or official social gathering or ceremony
- (noun) : a relation such that one thing is dependent on another
- (noun) : a vaguely specified social event
- (verb) : perform as expected when applied
- (verb) : serve a purpose, role, or function
- (verb) : perform duties attached to a particular office or place or function
- (noun) : (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- (noun) : a specific piece of work required to be done as a duty or for a specific fee
- (noun) : a damaging piece of work
- (noun) : the performance of a piece of work
- (noun) : the responsibility to do something
- (noun) : an object worked on; a result produced by working
- (noun) : a book in the Old Testament containing Job's pleas to God about his afflictions and God's reply
- (noun) : (computer science) a program application that may consist of several steps but is a single logical unit
- (noun) : any long-suffering person who withstands affliction without despairing
- (noun) : a Jewish hero in the Old Testament who maintained his faith in God in spite of afflictions that tested him
- (noun) : a state of difficulty that needs to be resolved
- (verb) : work occasionally
- (verb) : profit privately from public office and official business
- (verb) : invest at a risk
- (verb) : arranged for contracted work to be done by others
- (noun) : a workplace; as in the expression on the job'
- (verb) : have a craving, appetite, or great desire for
- (noun) : self-indulgent sexual desire (personified as one of the deadly sins)
- (noun) : a strong sexual desire
- (noun) : the act that results in something coming to be
- (noun) : an attribute that must be met or complied with and that fits a person for something
- (noun) : (usually plural) the components needed for making or doing something
- (verb) : put together out of artificial or natural components or parts
- (verb) : create or produce in a mechanical way
- (verb) : produce naturally
- (verb) : concoct something artificial or untrue
- (noun) : (computing) a discrete item that provides a description of virtually anything known to a computer
- (noun) : the act of occupying or taking possession of a building
- (noun) : any activity that occupies a person's attention
- (noun) : the control of a country by military forces of a foreign power
- (noun) : the period of time during which a place or position or nation is occupied
- (noun) : an opening remark intended to secure an advantage for the speaker
- (noun) : a maneuver in a game or conversation
- (noun) : the pervading meaning or tenor
- (noun) : a specific piece of work required to be done as a duty or for a specific fee
- (noun) : any piece of work that is undertaken or attempted
- (verb) : assign a task to
- (verb) : use to the limit
- (verb) : have a tendency or disposition to do or be something; be inclined
- (verb) : manage or run
- (verb) : have care of or look after
- (verb) : hold dear
- (verb) : regard highly; think much of
- (verb) : estimate the value of
- (noun) : relative darkness or lightness of a color
- (noun) : the quality (positive or negative) that renders something desirable or valuable
- (noun) : a numerical quantity measured or assigned or computed
- (noun) : an ideal accepted by some individual or group
- (noun) : the amount (of money or goods or services) that is considered to be a fair equivalent for something else
- (noun) : (music) the relative duration of a musical note
- (verb) : fix or determine the value of; assign a value to
- (verb) : evaluate or estimate the nature, quality, ability, extent, or significance of
- (verb) : have an effect or outcome; often the one desired or expected
- (verb) : prepare for crops
- (noun) : the occupation for which you are paid
- (verb) : cause to undergo fermentation
- (verb) : go sour or spoil
- (verb) : perform as expected when applied
- (verb) : make uniform
- (verb) : proceed along a path
- (noun) : activity directed toward making or doing something
- (noun) : a product produced or accomplished through the effort or activity or agency of a person or thing
- (noun) : (physics) a manifestation of energy; the transfer of energy from one physical system to another expressed as the product of a force and the distance through which it moves a body in the direction of that force
- (noun) : the total output of a writer or artist (or a substantial part of it)
- (noun) : a place where work is done
- (noun) : applying the mind to learning and understanding a subject (especially by reading)
- (verb) : provoke or excite
- (verb) : proceed towards a goal or along a path or through an activity
- (verb) : cause to work
- (verb) : be employed
- (verb) : exert oneself by doing mental or physical work for a purpose or out of necessity
- (verb) : cause to operate or function
- (verb) : operate in or through
- (verb) : operate in a certain place, area, or specialty
- (verb) : behave in a certain way when handled
- (verb) : arrive at a certain condition through repeated motion
- (verb) : move into or onto
- (verb) : shape, form, or improve a material
- (verb) : gratify and charm, usually in order to influence
- (verb) : move in an agitated manner
- (verb) : use or manipulate to one's advantage
- (verb) : have and exert influence or effect
- (verb) : give a workout to
- (noun) : skill in an occupation or trade
- (noun) : something intended as a guide for making something else
- (noun) : the creation of something in the mind
- (noun) : a decorative or artistic work
- (noun) : the act of working out the form of something (as by making a sketch or outline or plan)
- (noun) : a preliminary sketch indicating the plan for something
- (noun) : an arrangement scheme
- (verb) : intend or have as a purpose
- (verb) : plan something for a specific role or purpose or effect
- (verb) : create designs
- (verb) : make or work out a plan for; devise
- (verb) : conceive or fashion in the mind; invent
- (verb) : make a design of; plan out in systematic, often graphic form
- (verb) : create the design for; create or execute in an artistic or highly skilled manner
- (verb) : expect and wish
- (noun) : an inclination to want things
- (noun) : the feeling that accompanies an unsatisfied state
- (noun) : something that is desired
- (verb) : express a desire for
- (noun) : elaboration of an interpretation by the use of decorative (sometimes fictitious) detail
- (noun) : decorative needlework
- (noun) : (usually plural) the goal with respect to a marriage proposal
- (noun) : an act of intending; a volition that you intend to carry out
- (verb) : strive and make an effort to reach a goal
- (noun) : productive work (especially physical work done for wages)
- (noun) : a social class comprising those who do manual labor or work for wages
- (verb) : undergo the efforts of childbirth
- (noun) : a political party formed in Great Britain in 1900; characterized by the promotion of labor's interests and formerly the socialization of key industries
- (noun) : concluding state of pregnancy; from the onset of contractions to the birth of a child
- (noun) : an asset of special worth or utility
- (noun) : an occupation for which you are especially well suited
- (noun) : any piece of work that is undertaken or attempted
- (noun) : the trade of a funeral director
- (verb) : avail oneself to
- (noun) : (economics) the utilization of economic goods to satisfy needs or in manufacturing
- (noun) : the act of using
- (noun) : (law) the exercise of the legal right to enjoy the benefits of owning property
- (noun) : what something is used for
- (noun) : exerting shrewd or devious influence especially for one's own advantage
- (verb) : take or consume (regularly or habitually)
- (noun) : a particular service
- (verb) : seek or achieve an end by using to one's advantage
- (verb) : put into service; make work or employ for a particular purpose or for its inherent or natural purpose
- (verb) : use up, consume fully
- (noun) : (psychology) an automatic pattern of behavior in reaction to a specific situation; may be inherited or acquired through frequent repetition
- (verb) : habitually do something or be in a certan state or place (use only in the past tense)
- چھوٹا چھوٹا یا متفرق کام کرنا
- بڑے پیمانے پر اشیاء تیار کرنا
- خدمت یا خبر گیری سے دیکھ بھال کرنا
- سَر اِنجام دِيے گَئے کام کی خُوبی يا مَعيار
More words related to the meanings of kaam - کام
More words from English related to kaam - کام
View an extensive list of words below that are related to the meanings of the word kaam - کام meanings in English in English.
abluvionflowanxietycareconcerndesireheedcaressedabstrusearduousdifficultimpassableoperosehardonerousseveretryingembarrassmentirksomeobstaclepalacepinchpuzzlingthornyabstractcomplicateddifficultydilemmahardshiphot waterintricacyintricatenarrowoccultpainfulperplexityproblemsteeptangletenacioustortuoustoughtroubleuphillwearifulwearisomedifficilehardertuskydifficilitate ... difficultateabidebyesteemregardrespectreverevaluevenerateesteemingrespectingreverencingaccountappraisebalancecanvassestimateevaluatelibratetemptconsiderexamineinspectmonitornumberpalpscanverifyviewweigh upvettingdetesttatecheckaccustomfamiliarisehabituateinureusehabituatingachievemententerpriseploycampaigntaskundertakingweightyexpeditionaryexpedimentacquiescenceapprobationchoiceconsentpickapprovalassentpleasurevolitionwillwillsactfirjobslitbutton holelabouroperationbrick trowelradialjointertrowelcurneyverbcaryalegerdemainacrobaticsartfeatjuggleryperformanceshenaniganskillsleight of handtacticstrickschauntactscarlewdmanufacturedutyemploymentmissionprofessionutilityworkactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitgestmeasurenounpracticeprocedureprocessworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresactivepretencepretextverbenaverbosenessverbalsverberatesverbidverbidsverbsverismmangrovemoulderoperatecommitdomakemake doto renddischargeeffectuate obeymovemoseysnapmovingnessacupuncturehowlyapululatewaffyipbargingbarkingbuskingaffairscommercializationtransactionbankingbusinessdealingsgive and taketrucktransactionstransactedtransactstradingtradeaffairboskinessbusinessesturnoversaffectationartificialityconstructionconcoctionconformationdispositionedificationequipmentfacefalsification feignfeint fictionfigmentforgingnatureshamtextureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizesairsemblazonryparadeshowinessclaptrapdisplayglossostentationpretentionseemingseemingnesssemblanceshowshow offsplurgeveneerpretendingpretensepretencespretendantpretenderspretendspretensesshewingpretendencepretendershippretensedpretextureformatgetupsetupconfigurationshapesubstructureconstructurefructureaffectionneeddemandlikinglonginglovenecessityurgencywantwellwishingyearningaffianceengagementbetrothalespousalhandpromiseaffiliationimputationrapportaffinitycomparisoncorrelationproportionratioregardingrelationlinealityaffluxappetitesmindednesspropendencytendencyardent desirestrong desirehabitudeinclinationinducementpredispositionwishalluresalureobdurenessaffiliateconstituteconstructcreateerectfablefabricatefoundframemanufacturesmouldbuildcoinconfigureedifyforgeinitiatelaughproducevampfabricatingmeakingaggravatedconsolidateddiamonddrasticegregiousimpenitentimpetuousmoroseobdurateoppressiveoutrageousrawstrongstiffstringentstonycallouscruelexactingextremefirmflintygrimharshheathenishheavyhigh handedhornyinclementindurateinelasticinexorableinflexibleintenseironcladlaboriousloudnippingrigidrigourousstrengthenedstrictsturdytautunbendinguncompromisingunmercifulvehementviolentwoodenargentoushardeninglacrimalraucousriblessrigoutscrumptiousscrumpysorbentsternutativesternutatorystiffenerstratifiedstumpytoilsometoughenedtouterwrothfuldurstfiercerfiercestfierierfoughtyfructuousharrowedharshenedhushymordentseverersternersterniticsternwardstiedstiffenedstifferstiffishstilleststiverstoorstratousstreperousstrichstricterstricturedstridulantstridulousstrifefulstripelessstrumaticstrumousstruthiousstruttedtartareoustatoustattiertautenedtightenedtightenstightertoilfultorminoustorrefiedtoughenertoughenerstougheningtoughertoughishtouzletouzledtouzlingtrothfultushyverrucousconstringentdurefulefferousenervousharborousliefsomepiligerousquerciterigidulousroboreousslentsordiferousstibiousstrigousstrudestupeoussturkswoughtartaroustentiginousteretoustergeminousterreoustonoustureenfulustoriouswieldsomeapeemulatefollow:gesticulateimitatemimicmockmodelnarratequotesimulatetranscribingcopycounterfeitduplicateimpersonatepersonaterelateremittake aftertranscribetransferduplicatingapishnessavaricecupiditygreedinessambitioncovetousnessgreedmammonvoracityapparitioncontoureffigy emblemfigureguiseidealinementlikenessmannersimilitudeappearanceaspectconditiondiagramfeatureformformationgestaltget upimagemodenumeralpatternstatevarietywayshape upamorphismapplicationutilizationcurrencyusageutilisationouseusanceharnessesintuseonusesurusesusagesusancesustionutilisesutilizesgaugejudgevaluateappropriationratificationappointmentdesignationinstallationhungerkeennessrequesturgedesirabilitydesirablenesswillfulnesswishfulnesscravingsdesipiencedesiringdesistancewantagewishedasperationaspirementconspirationdesirefulnessdesirousnessdesitionwishedlywishlywouldingnessarchetypeessence fundamentalprincipalvegetablemolmoolardourearnestnesshurrycravingzealdistress ticklishinconvenientintractablewell earnedlivelihoodemployablejobswortharduousnessendeavorswotdiligenceexerciseexertionhard worktoiltravailtrialarrestconfinedissuadeencumber immanacleletobjectobstructobviatepreventprescribesquenchtaboovetowardwithholdavertbarcohibitcontaincurbdetainfendforestallhefthinderimpedeinhibitinterdictinterfereknock offoccludeprohibitrepressrestrainstintstopstrainward offclog upcurbingdiscontinuancefend forfend offinhibitedinhibitorinhibitorykerbobtrude uponwithholdingcurbeddisinhibitfendingfendsforhentinghalteringinhibitinginhibitivewithholdeninterceptingobstringeprelimitarticlehypostatismateriawareitemthingbreadthbroadnessentreatyobsecrationwidthappealerrand expositionlatitudepetitionrepresentationreviewsolicitationstatementbrowseicefrostfrostyfrolicsfrostierrearedburdencommercemongeringtrafficmerchandisingtradtradeoffcommercedcommercingmerktradestradesfolktradingsoutletshopstoreboutiquedepartment storefirmestfermecallingcareercraftmetieroccupationofficevocationprodsproosamusementpasttimecalefactionebullitioneffervescenceemotionemotionalityenthusiasm fermentationfervencyfervorflare upflushfuryhotnessoutbreakpassionparoxysmrapturevervvervevivacityboilingcoctionditherelanexcitementfervourfrenzygustoheatimpetuslustspiritednessvimwarmthastringescaresscoquetrycordialityrelishchousezhouchawschowschargejurisdicationoccupancyprerogativechoreobligatoryobligationsdivine ordinanceon handincumbentincumbencyindispensablemoral obligationresponsibilitystatutesuppositionassuetudesassumpsitassuefactionsupposurechartdrawingmapmoduleprofiletenordelineationdesignexamplefeaturesplanportraitpredicamentprospectsketchindraftengraftationchiefoptionsupersedeabbreviationadoptionauthoritycontroldiscretionimprimaturjurisdictionpowerpossessivenessauthorismobreptionchildbearingmaternitymaternalismmaternalisticmotherlinessmateriatemateriationobstetricycherishnursebreedbring upnourishreartametendtrainclaimevokeinvokerequiresolicitsummoninginvocatinginvokingrequitingsummonsingesquiringclutchencroachmentgraspgripholdkeepingmanubriummasterytenurehafthandlehilthingeholdingknuckle jointpossessingpossessionseizuretenementusurpationhinge uponcapturesgrabensoccupanceoccupiescapottedconstuprationepiscopatedobductionobovalpossessionarypossessivalclambereffortendeavouressayessaysattempttrytrysailattemperamentattemperanceattemperationefformationeffrenationeffundendeavormentconsigndelegatedeliverdevolveentrustresigncontentspurportspurportstrainedaimimportintentintentionmeaningmotivepurposesensemeanlyimplyingmeanermeanesmeaniesmeanwhilescontextagreementarrangementconnectionmethodordersystemcotcradleembosomfosternestlenurturenuzzlekeepprotectraisefosterlingcradledcradlescradlingcribblecribbledcribrouscribworkfosteringscherisingconsequencesconsequencehonourimportanceoutweighsamountappreciationcreditdegreedignityfavourgreatnessmagnitudemeritmodulusquantityvalenceworthvalorizesvalurejurisprudenceanimusintentnessresolvewouldinterpretationsentencesignificancemeaningsmpretcompanycaptorgovernanceimpactimpressioninfluencemarkruinsigntouchtraceeffervescencyaffectednesseffectivityeffectoreffectuationeffendieffervesceeffervescingimpactiontake effecteffaceseffeireffierceeffingefforceeffrayeffseffulgeseffusesrefluenceseffectioneffectuatingeffectuoseeffeteffluencycollateralityguaranteemortgageassurancebailbondguarantysecuritysuretywarrantybailmentbailieshipbailingsurementconationdecisiondeterminationfortitudemoralewillpowercommittednessdeterminatenessdeterminismconsoluteagnitioncommittiblededitiondegeneratenessdeterminabilitydeterminablenessdeterminacydetersivelydetersivenessdevolutepectinationresolvednessconducegravitatelikemindleanvergeinclinnationto be inclinedcropgizzardmagnanimitymawcapacitycourageresolutionspiritgiredateepochobstrictionpledgetimevowagecontractepoqueeragageperiodpromisereignstipulationwordpactioncoventspledgeablepledgetstenespamentstithdaughtercontrivancefashionfittingneebintdallydisport faddle frolicgameamuseplayrompsportplay offplay outplay upplayinggimletedgimletingdisbursespendwasteexpendingincurvecompenddiscontentlustfulnesshosslustinglustratedlustreddissentimpugimpugnchallengecriticisetake exceptionrecuseobjectingobjuringdisadvantageentanglementimplexionquandaryhardnessdisclose dissuadesstruggleinterceptopposeresistwithstanddroophookoverhangslopebowcondescendinclinekneellanguishlobpropendreclineslouchstooptiltwiltbinkbenddreamthoughtintendanceintendancyintendmentintinctionintendimentintentationhobbypartialityaspirationeagernessfancyfondnessinterestpredilectiontasteadienceavidnessfondantfondlerfonduehobbeshobbyhorsehobbyismpassionatenesserubescentfondedfonderfondingfondledfondlersfondlingsfondsfonduesgustinesshobbieshobbitryhobbitshoboeslustihoodowlishnessfondehobbismhobbyhorsicalindecenceobdurednessdesideratumhankeringsolicitudeyenarvoslongingsefficiencypertestembassymissiveadvicemessagenewsemployservicejob lotredeploymentjobationjobbedjobbingservitureministrationserve upservicingservicedservageserviceageemphasisimperativenessmomentousnesssubstantialmainmeaningfulnesssignificaionworthinesscrucialityparamountcymatteredpraefectpraefectsprominencyvalorisesimportunacynotabilitiespronitysignificancysignificavitploymentsentimentfeelinggingermettleragepassiontidemisemploymentbusynessengorgementengrossmentengagednessembogueepithetattributequalityvirtueequalwhateveras many asdrudgeyokeerectionfineryfopperymake outrabbistalkawarenessinformationintelligenceknowledgenoticereportrumourwatchfulnesstidmalleatefalsifyfudgeinventtrumpfairnesseleganceexcellencegoodnessgracehandsomenessmasterworknicenesswellnessfireangerbaleflameincensementfaeryfiacresfiresfirryfirefishfishing netmoneynettrapbaitbidconspiracycostdecoylatchloanpricesnaretrepanfleetraftfloatstag beetleravelmentruftflounceleapwritheyearnfurrowingfrettenfrequencyreiterancereiterantrepeatingsrepeoplesframeworkskeletonchassisphysiqueschemeact onimplementationcompliedcompliesdiscompliancefurrowgainadvantagebehoofbenefitharvestleverageprofitresultusefulnessvantageyieldadvantageousnessbenefactbeneficbeneficebeneficiationgainfulnessavisementavisesavizesbenemptgainersgainsayswainageavailmentbeneficialnessbenemegainagerewegesturemovementstoppagevelocityfault gesticulationmischiefwagmotioningproficiencytechniqueaccomplishmentdeftnessdexterityingenuityknackknow howmasterlinessworkmanshipadeptnessarithmancydextralityexcellencyexpertnesshandednessmerceriseparticularisespecialisespecialismspecializespecialnesssupinationambittyexpertisesmasterhoodmasteringsskillingsskillsdeisticalnessdevexitydextericaldexterousnessimpertinencyproficienceskilligaleeguardhodmangrubberjobberjourneymanlabourerworkerlaborlaboredlaborerlabouredlaborerslaboristlaboristslaborslabourerslabouristlabouristslabourslaboursomelaborantlaborsomehopeexpectationfaithmainstayrefugeresourceshelterhoodwinkingutilisebeneficiateleveragingto advantageavailingavisingavizingadvantagingappetiteimperviousimploremanducatemasticateproposehankeroughtwagesjob workwagelaboringlaborismlabourismdrunkennessintoxicationpetulancefunnylecherysexual desirehotnymphomaniapungencymagnificencedecorationequipage pompsplendourmanoeuvremixturesynthesistempercompositiondecoctioninventionreciperusetricksyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismindustrymanipulationmasturbationself pollutionmanipulatenattinessartistic workproductstillact upfunctioningwork upaworkingtamperaccesscompetenceentryintrusionreachintortionbelongingcommoditychezthinghoodthinginessthingnesschesmaterialmicracletenancyamendingchangingturningdisposesdisposingdisopiniondisposednessdisposementdescriptionfoundation stylesuperiorsurpassingtypemoildestinationgoalimplicationobjectiveejectivemottemottoedobjectivationpurposernegotiationmarketingshoppingpittanceappanagegrantpensionreligious broodingstipendstipelstipellatestipelsstipendsstipitesstipendiariesstipendiatestipitiformstipulaeavocationhobbyisthobbyistssecdrift pointmeantsepalembroiderysuperviseconcern forlook afterwarrantfatiguelaboriousnesswork outworkoutperdureexertmenttakecareconsultreferreturn toutilizeongoingproceedingaddictionaddictionsadditamentadhibitionlaithwannablankbuttoffertargettargeadmixtionclevernessneatnessassessmentcapitalinvestmentwealthworthiesassigneeattorneyfunctionarymanagerbocageneedleworkconsumeharnessingutilisingutilizingempuseusuringdominancedominationswaydomiciliationdynamizationvaluablenesscostatecostingcostusrootcostatedcostrelpricedthirstthirsterthirstinesspaeanspowansthirstersthirstierthirststhirstleregretetiolationfrethonepinerememberdesperationfrustrationthwartchicanaschickeninglaceextractwokidolpaintingpicturesweetheartsettlementunderstandingindispositionsicknessutilitariandowdinesseffectualityeffectualnessefficaciousnessexactionhandinesshelpfulnessrapacityrowdyismuseablenessutilebanalitiesefficacityefficienceefficientsegalitieseuphoniesevitationsexigencefutilitiesidealitiesmunifiencenativitiesoperosityriftyutilitiesvantagesvernationsaffectibilityaffordmentaffraymentdentilationeupathyfedityimproficienceimproficiencypontificalityraucityrubefaction
Idioms with the word kaam - کام in it
Idioms related to the meaning of kaam - کام
What are the meanings of kaam - کام in English?
Meanings of the word kaam - کام in English are act, action, arduous, business, calling, employment, engagement, errand, function, job, lust, making, manufacture, object, occupation, ploy, purport, task, tend, value, work, workmanship, design, desire, embroidery, intention, labour, metier, undertaking, use, chores, kam, com and werk. To understand how would you translate the word kaam - کام in English, you can take help from words closely related to kaam - کام or it’s English translations. Some of these words can also be considered kaam - کام synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word kaam - کام. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use kaam - کام in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say kaam - کام in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of kaam - کام with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by کام?
Meanings of کام are act, action, arduous, business, calling, employment, engagement, errand, function, job, lust, making, manufacture, object, occupation, ploy, purport, task, tend, value, work, workmanship, design, desire, embroidery, intention, labour, metier, undertaking, use, chores, kam, com and werk
Whats the definition of کام?
Definition of the کام are
- something that people do or cause to happen
- a legal document codifying the result of deliberations of a committee or society or legislative body
- a subdivision of a play or opera or ballet
- a manifestation of insincerity
- perform an action, or work out or perform (an action)
- be engaged in an activity, often for no particular purpose other than pleasure
- be suitable for theatrical performance
- discharge one's duties
- play a role or part
- perform on a stage or theater
- pretend to have certain qualities or state of mind
- have an effect or outcome; often the one desired or expected
- behave unnaturally or affectedly
- a short performance that is part of a longer program
- put in effect
- something done (usually as opposed to something said)
- the most important or interesting work or activity in a specific area or field
- an act by a government body or supranational organization
- the operating part that transmits power to a mechanism
- the trait of being active and energetic and forceful
- the series of events that form a plot
- a military engagement
- a judicial proceeding brought by one party against another; one party prosecutes another for a wrong done or for protection of a right or for prevention of a wrong
- difficult to accomplish; demanding considerable mental effort and skill
- taxing to the utmost; testing powers of endurance
- characterized by effort to the point of exhaustion; especially physical effort
- incidental activity performed by an actor for dramatic effect
- a rightful concern or responsibility
- an immediate objective
- business concerns collectively
- the activity of providing goods and services involving financial and commercial and industrial aspects
- customers collectively
- the volume of commercial activity
- the particular occupation for which you are trained
- the state of being employed or having a job
- the occupation for which you are paid
- the act of giving someone a job
- the act of using
- a meeting arranged in advance
- the act of giving someone a job
- employment for performers or performing groups that lasts for a limited period of time
- the act of sharing in the activities of a group
- contact by fitting together
- a mutual promise to marry
- the actions and activities assigned to or required or expected of a person or group
- what something is used for
- a formal or official social gathering or ceremony
- a relation such that one thing is dependent on another
- a vaguely specified social event
- perform as expected when applied
- serve a purpose, role, or function
- perform duties attached to a particular office or place or function
- (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- a specific piece of work required to be done as a duty or for a specific fee
- a damaging piece of work
- the performance of a piece of work
- the responsibility to do something
- an object worked on; a result produced by working
- a book in the Old Testament containing Job's pleas to God about his afflictions and God's reply
- (computer science) a program application that may consist of several steps but is a single logical unit
- any long-suffering person who withstands affliction without despairing
- a Jewish hero in the Old Testament who maintained his faith in God in spite of afflictions that tested him
- a state of difficulty that needs to be resolved
- work occasionally
- profit privately from public office and official business
- invest at a risk
- arranged for contracted work to be done by others
- a workplace; as in the expression on the job'
- have a craving, appetite, or great desire for
- self-indulgent sexual desire (personified as one of the deadly sins)
- a strong sexual desire
- the act that results in something coming to be
- an attribute that must be met or complied with and that fits a person for something
- (usually plural) the components needed for making or doing something
- put together out of artificial or natural components or parts
- create or produce in a mechanical way
- produce naturally
- concoct something artificial or untrue
- (computing) a discrete item that provides a description of virtually anything known to a computer
- the act of occupying or taking possession of a building
- any activity that occupies a person's attention
- the control of a country by military forces of a foreign power
- the period of time during which a place or position or nation is occupied
- an opening remark intended to secure an advantage for the speaker
- a maneuver in a game or conversation
- the pervading meaning or tenor
- a specific piece of work required to be done as a duty or for a specific fee
- any piece of work that is undertaken or attempted
- assign a task to
- use to the limit
- have a tendency or disposition to do or be something; be inclined
- manage or run
- have care of or look after
- hold dear
- regard highly; think much of
- estimate the value of
- relative darkness or lightness of a color
- the quality (positive or negative) that renders something desirable or valuable
- a numerical quantity measured or assigned or computed
- an ideal accepted by some individual or group
- the amount (of money or goods or services) that is considered to be a fair equivalent for something else
- (music) the relative duration of a musical note
- fix or determine the value of; assign a value to
- evaluate or estimate the nature, quality, ability, extent, or significance of
- have an effect or outcome; often the one desired or expected
- prepare for crops
- the occupation for which you are paid
- cause to undergo fermentation
- go sour or spoil
- perform as expected when applied
- make uniform
- proceed along a path
- activity directed toward making or doing something
- a product produced or accomplished through the effort or activity or agency of a person or thing
- (physics) a manifestation of energy; the transfer of energy from one physical system to another expressed as the product of a force and the distance through which it moves a body in the direction of that force
- the total output of a writer or artist (or a substantial part of it)
- a place where work is done
- applying the mind to learning and understanding a subject (especially by reading)
- provoke or excite
- proceed towards a goal or along a path or through an activity
- cause to work
- be employed
- exert oneself by doing mental or physical work for a purpose or out of necessity
- cause to operate or function
- operate in or through
- operate in a certain place, area, or specialty
- behave in a certain way when handled
- arrive at a certain condition through repeated motion
- move into or onto
- shape, form, or improve a material
- gratify and charm, usually in order to influence
- move in an agitated manner
- use or manipulate to one's advantage
- have and exert influence or effect
- give a workout to
- skill in an occupation or trade
- something intended as a guide for making something else
- the creation of something in the mind
- a decorative or artistic work
- the act of working out the form of something (as by making a sketch or outline or plan)
- a preliminary sketch indicating the plan for something
- an arrangement scheme
- intend or have as a purpose
- plan something for a specific role or purpose or effect
- create designs
- make or work out a plan for; devise
- conceive or fashion in the mind; invent
- make a design of; plan out in systematic, often graphic form
- create the design for; create or execute in an artistic or highly skilled manner
- expect and wish
- an inclination to want things
- the feeling that accompanies an unsatisfied state
- something that is desired
- express a desire for
- elaboration of an interpretation by the use of decorative (sometimes fictitious) detail
- decorative needlework
- (usually plural) the goal with respect to a marriage proposal
- an act of intending; a volition that you intend to carry out
- strive and make an effort to reach a goal
- productive work (especially physical work done for wages)
- a social class comprising those who do manual labor or work for wages
- undergo the efforts of childbirth
- a political party formed in Great Britain in 1900; characterized by the promotion of labor's interests and formerly the socialization of key industries
- concluding state of pregnancy; from the onset of contractions to the birth of a child
- an asset of special worth or utility
- an occupation for which you are especially well suited
- any piece of work that is undertaken or attempted
- the trade of a funeral director
- avail oneself to
- (economics) the utilization of economic goods to satisfy needs or in manufacturing
- the act of using
- (law) the exercise of the legal right to enjoy the benefits of owning property
- what something is used for
- exerting shrewd or devious influence especially for one's own advantage
- take or consume (regularly or habitually)
- a particular service
- seek or achieve an end by using to one's advantage
- put into service; make work or employ for a particular purpose or for its inherent or natural purpose
- use up, consume fully
- (psychology) an automatic pattern of behavior in reaction to a specific situation; may be inherited or acquired through frequent repetition
- habitually do something or be in a certan state or place (use only in the past tense)
- چھوٹا چھوٹا یا متفرق کام کرنا
- بڑے پیمانے پر اشیاء تیار کرنا
- خدمت یا خبر گیری سے دیکھ بھال کرنا
- سَر اِنجام دِيے گَئے کام کی خُوبی يا مَعيار
What is the synonym of کام?
Synonym of word کام are کام, کاج, کرتوت, کرنی, کریا, کرتب, کار, عمل, فعل, کرنا
What are the idioms with the word کام?
Here are the idioms with the word کام in them.
- Be content with friend sincerity
- Be content with friends sincerity
- Better do it than wish it done
- Charity begins at home
- Enquire not what's in another's pot
What are the idioms related to کام?
Here are the idioms that are related to the word کام.
- Friends are lost by calling often and calling seldom
- Man punishes the action but god the intention
- An act done against my will is not my act
- Business and action strengthen the brain but much study weaknes it
- Better go to heaven in rags than to hell in embroidery