Paishwayi - پیشوائی meanings in English
Paishwayi - پیشوائی meanings in English are conduct, forerun, guidance, lead, leadership Paishwayi - پیشوائی in English. More meanings of paishwayi - پیشوائی, it's definitions, example sentences, related words, idioms and quotations.
Paishwayi - پیشوائی Definitions
Please find 44 English and definitions related to the word Paishwayi - پیشوائی.
- (verb) : transmit or serve as the medium for transmission
- (verb) : behave in a certain manner
- (noun) : (behavioral attributes) the way a person behaves toward other people
- (verb) : direct the course of; manage or control
- (verb) : lead, as in the performance of a composition
- (verb) : lead musicians in the performance of
- (noun) : manner of acting or controlling yourself
- (noun) : something that provides direction or advice as to a decision or course of action
- (noun) : the act of setting and holding a course
- (noun) : the act of guiding or showing the way
- (verb) : preside over
- (verb) : lead, as in the performance of a composition
- (verb) : be conducive to
- (verb) : be in charge of
- (noun) : the playing of a card to start a trick in bridge
- (noun) : mixture of graphite with clay in different degrees of hardness; the marking substance in a pencil
- (noun) : thin strip of metal used to separate lines of type in printing
- (noun) : an advantage held by a competitor in a race
- (noun) : evidence pointing to a possible solution
- (noun) : the introductory section of a story
- (noun) : a news story of major importance
- (noun) : (baseball) the position taken by a base runner preparing to advance to the next base
- (noun) : the angle between the direction a gun is aimed and the position of a moving target (correcting for the flight time of the missile)
- (noun) : the timing of ignition relative to the position of the piston in an internal-combustion engine
- (noun) : an indication of potential opportunity
- (noun) : a jumper that consists of a short piece of wire
- (noun) : restraint consisting of a rope (or light chain) used to restrain an animal
- (noun) : an actor who plays a principal role
- (verb) : tend to or result in
- (verb) : be ahead of others; be the first
- (verb) : cause to undertake a certain action
- (verb) : travel in front of; go in advance of others
- (verb) : lead, extend, or afford access
- (verb) : cause something to pass or lead somewhere
- (verb) : move ahead (of others) in time or space
- (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (noun) : (sports) the score by which a team or individual is winning
- (noun) : a soft heavy toxic malleable metallic element; bluish white when freshly cut but tarnishes readily to dull grey
- (noun) : a position of being the initiator of something and an example that others will follow (especially in the phrase take the lead')
- (verb) : produce as a result or residue
- (noun) : the activity of leading
- (noun) : the ability to lead
- (noun) : the body of people who lead a group
- (noun) : the status of a leader
More words related to the meanings of Paishwayi - پیشوائی
More words from English related to Paishwayi - پیشوائی
View an extensive list of words below that are related to the meanings of the word Paishwayi - پیشوائی meanings in English in English.
carryconveygetleadbearwaftcarry overmarchconfersendaccompanyconductescortreachtransmitconveyancingconveyingconveyalcautioncustomizecustomizingdirectionguidanceadvicedirectiveinitiativeinjunctioninstructionpreceptroadmapdirectingdirectivenessdirectivityguideddirectivesdiremptdiremptiondiremptsguidguidageindirectedceremonialcraftgadgetmachinationmanoeuvremotionmovemovementpassage ... speedstepstrategysubterfugeactivityanticcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackchargemanagementprovisionlinedardentnessarrangementgovernancemethodorderorganisationmanageabilitymanageablenessguideshipmentoringdictatorapproach patternbehaviorismbehavioristicmodalisticconductorymoralsmorescharacterconductanceconductibilityculerageinvigilancedistendenhance enlargeforerungrowlengthenmantlemultiplyoutflyoutnumberoverstepthrivevegetatewaxincreaseknitmountnoseproceedprosperfiatcommandimportunityurgencydemandinsistenceneedfulnesspilotsprecedeleadershiphegemonyleadinglead upleadedtinpewterserbmonitionpremonishmenttestacywarningadmonitioncounselexhortationlessonmoral lessonpremonitionadmonishmentadvisementexhortexhortsadhortationadvisednesspromenadetenortrackhabithabitudewayfuriesbehaviourguisemannerstylebiographydispositionqualitytraitserrationseuratbiographoleographyserratureserenitudewayschieftainshipserverysuradditionkindknackmannerismmienmodeshivahshivahsguide
Idioms related to the meaning of Paishwayi - پیشوائی
What are the meanings of Paishwayi - پیشوائی in English?
Meanings of the word Paishwayi - پیشوائی in English are conduct, forerun, guidance, lead and leadership. To understand how would you translate the word Paishwayi - پیشوائی in English, you can take help from words closely related to Paishwayi - پیشوائی or it’s English translations. Some of these words can also be considered Paishwayi - پیشوائی synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Paishwayi - پیشوائی. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Paishwayi - پیشوائی in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say Paishwayi - پیشوائی in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Paishwayi - پیشوائی with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by پیشوائی?
Meanings of پیشوائی are conduct, forerun, guidance, lead and leadership
Whats the definition of پیشوائی?
Definition of the پیشوائی are
- transmit or serve as the medium for transmission
- behave in a certain manner
- (behavioral attributes) the way a person behaves toward other people
- direct the course of; manage or control
- lead, as in the performance of a composition
- lead musicians in the performance of
- manner of acting or controlling yourself
- something that provides direction or advice as to a decision or course of action
- the act of setting and holding a course
- the act of guiding or showing the way
- preside over
- lead, as in the performance of a composition
- be conducive to
- be in charge of
- the playing of a card to start a trick in bridge
- mixture of graphite with clay in different degrees of hardness; the marking substance in a pencil
- thin strip of metal used to separate lines of type in printing
- an advantage held by a competitor in a race
- evidence pointing to a possible solution
- the introductory section of a story
- a news story of major importance
- (baseball) the position taken by a base runner preparing to advance to the next base
- the angle between the direction a gun is aimed and the position of a moving target (correcting for the flight time of the missile)
- the timing of ignition relative to the position of the piston in an internal-combustion engine
- an indication of potential opportunity
- a jumper that consists of a short piece of wire
- restraint consisting of a rope (or light chain) used to restrain an animal
- an actor who plays a principal role
- tend to or result in
- be ahead of others; be the first
- cause to undertake a certain action
- travel in front of; go in advance of others
- lead, extend, or afford access
- cause something to pass or lead somewhere
- move ahead (of others) in time or space
- stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (sports) the score by which a team or individual is winning
- a soft heavy toxic malleable metallic element; bluish white when freshly cut but tarnishes readily to dull grey
- a position of being the initiator of something and an example that others will follow (especially in the phrase take the lead')
- produce as a result or residue
- the activity of leading
- the ability to lead
- the body of people who lead a group
- the status of a leader
What is the synonym of پیشوائی?
Synonym of word پیشوائی are پہنچانا, ہدایت, چال, اہتمام, انتظام, کار روائی, پیشوائی, رہنمائی, اگوائی, طرز عمل
What are the idioms related to پیشوائی?
Here are the idioms that are related to the word پیشوائی.
- All roads lead to rome
- Butter is gold in the morningilver at noor lead at night
- Crosses are ladders that lead to heaven
- Lead by the nose
- Lead one a dance