ley jaana - لے جانا meanings in English
ley jaana - لے جانا Definitions
Please find 123 English and definitions related to the word ley jaana - لے جانا.
- (noun) : the act of carrying something
- (verb) : continue or extend
- (verb) : capture after a fight
- (verb) : have on the surface or on the skin
- (verb) : take further or advance
- (verb) : compensate for a weaker partner or member by one's own performance
- (verb) : extend to a certain degree
- (verb) : win approval or support for
- (verb) : be necessarily associated with or result in or involve
- (verb) : have or possess something abstract
- (verb) : keep up with financial support
- (verb) : have with oneself; have on one's person
- (verb) : be conveyed over a certain distance
- (verb) : have as an inherent or characteristic feature or have as a consequence
- (verb) : include, as on a list
- (verb) : sing or play against other voices or parts
- (verb) : serve as a means for expressing something
- (verb) : pass on a communication
- (verb) : be successful in
- (verb) : win in an election
- (verb) : secure the passage or adoption (of bills and motions)
- (verb) : cover a certain distance or advance beyond
- (verb) : have a certain range
- (verb) : be able to feed
- (verb) : drink alcohol without showing ill effects
- (verb) : bear or be able to bear the weight, pressure,or responsibility of
- (verb) : propel or give impetus to
- (verb) : bear (a crop)
- (verb) : include as the content; broadcast or publicize
- (verb) : pursue a line of scent or be a bearer
- (verb) : transfer (a number, cipher, or remainder) to the next column or unit's place before or after, in addition or multiplication
- (verb) : transfer (entries) from one account book to another
- (verb) : have on hand
- (verb) : move while supporting, either in a vehicle or in one's hands or on one's body
- (verb) : support or hold in a certain manner
- (verb) : contain or hold; have within
- (verb) : be pregnant with
- (verb) : transmit or serve as the medium for transmission
- (verb) : behave in a certain manner
- (verb) : propel
- (verb) : be equipped with (a mast or sail)
- (verb) : serve as a means for expressing something
- (verb) : transmit or serve as the medium for transmission
- (verb) : transmit a title or property
- (verb) : transfer to another
- (verb) : (of information) make known; pass on
- (verb) : come into the possession of something concrete or abstract
- (verb) : reach a destination; arrive by movement or progress
- (verb) : be a mystery or bewildering to
- (verb) : cause to do; cause to act in a specified manner
- (verb) : take the first step or steps in carrying out an action
- (verb) : be stricken by an illness, fall victim to an illness
- (verb) : receive a specified treatment (abstract)
- (verb) : take vengeance on or get even
- (verb) : receive as a retribution or punishment
- (verb) : purchase
- (verb) : acquire as a result of some effort or action
- (verb) : reach by calculation
- (verb) : communicate with a place or person; establish communication with, as if by telephone
- (verb) : cause to move; cause to be in a certain position or condition
- (verb) : overcome or destroy
- (verb) : evoke an emotional response
- (verb) : irritate
- (verb) : reach and board
- (verb) : achieve a point or goal
- (verb) : give certain properties to something
- (verb) : enter or assume a certain state or condition
- (verb) : undergo (as of injuries and illnesses)
- (verb) : leave immediately; used usually in the imperative form
- (verb) : grasp with the mind or develop an understanding of
- (verb) : earn or achieve a base by being walked by the pitcher
- (verb) : go through (mental or physical states or experiences)
- (noun) : a return on a shot that seemed impossible to reach and would normally have resulted in a point for the opponent
- (verb) : make (offspring) by reproduction
- (verb) : preside over
- (verb) : lead, as in the performance of a composition
- (verb) : be conducive to
- (verb) : be in charge of
- (noun) : the playing of a card to start a trick in bridge
- (noun) : mixture of graphite with clay in different degrees of hardness; the marking substance in a pencil
- (noun) : thin strip of metal used to separate lines of type in printing
- (noun) : an advantage held by a competitor in a race
- (noun) : evidence pointing to a possible solution
- (noun) : the introductory section of a story
- (noun) : a news story of major importance
- (noun) : (baseball) the position taken by a base runner preparing to advance to the next base
- (noun) : the angle between the direction a gun is aimed and the position of a moving target (correcting for the flight time of the missile)
- (noun) : the timing of ignition relative to the position of the piston in an internal-combustion engine
- (noun) : an indication of potential opportunity
- (noun) : a jumper that consists of a short piece of wire
- (noun) : restraint consisting of a rope (or light chain) used to restrain an animal
- (noun) : an actor who plays a principal role
- (verb) : tend to or result in
- (verb) : be ahead of others; be the first
- (verb) : cause to undertake a certain action
- (verb) : travel in front of; go in advance of others
- (verb) : lead, extend, or afford access
- (verb) : cause something to pass or lead somewhere
- (verb) : move ahead (of others) in time or space
- (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (noun) : (sports) the score by which a team or individual is winning
- (noun) : a soft heavy toxic malleable metallic element; bluish white when freshly cut but tarnishes readily to dull grey
- (noun) : a position of being the initiator of something and an example that others will follow (especially in the phrase take the lead')
- (verb) : produce as a result or residue
- (verb) : put up with something or somebody unpleasant
- (verb) : take on as one's own the expenses or debts of another person
- (verb) : support or hold in a certain manner
- (verb) : contain or hold; have within
- (verb) : be pregnant with
- (verb) : behave in a certain manner
- (verb) : have rightfully; of rights, titles, and offices
- (verb) : bring in
- (noun) : massive plantigrade carnivorous or omnivorous mammals with long shaggy coats and strong claws
- (verb) : have on one's person
- (verb) : cause to be born
- (verb) : move while holding up or supporting
- (noun) : an investor with a pessimistic market outlook; an investor who expects prices to fall and so sells now in order to buy later at a lower price
- (verb) : transfer from one time period to the next
- (verb) : transfer or persist from one stage or sphere of activity to another
- (verb) : transport from one place or state to another
- (verb) : hold over goods to be sold for the next season
- (noun) : the accumulated and undivided profits of a corporation after provision has been made for dividends and reserves
- (noun) : application of a skill learned in one situation to a different but similar situation
More words related to the meanings of ley jaana - لے جانا
More words from English related to ley jaana - لے جانا
View an extensive list of words below that are related to the meanings of the word ley jaana - لے جانا meanings in English in English.
abductwaftkidnapmoochacceptcatchgettakeobtainundergolenasoaksoak upsoakageaccordblenchchafedco operatecomportconcurcongregatecorrespondentcoupleconnectfindfretgaingreetkneadknitleaguemashminglemixoccurquadratetallyclubcombineconsistintroducejoinmeetconfreremeetnessacquirecreditsprocureachieveknow ... overtakereceiverecognisesecurewrenchdrawearncollectpick uppossesswrangleattaintacquistattaintingavulsinggaininggetteringacquitteraffiliatearisecreateengender fathergenerategrowmakemanufacturespropagateswakenbreedelicitgenderinventmanifestprocreateproduceteemyieldarousinggeneratingingenerateproducingapproachvestarriveattainreachdispeacedepeacharousedisseat erectfabricatehoistobliterateprologuecarryknock upliftraisetweezewakehaul upprick upraise uphoisingunweavingawrekeincurvatingbuildupcullbillowsurgeundulationwaveecstasyemotionexcitementrapturewavebandwaveletlehrwavewornblastgalegustrushconveyleadmarchtransportbearhaultoteconfersendaccompanyconductescorttransmitconveyancingconveyingconveyalclapper claweateatingfeedmushnutrimentpabulumviandconsumedinedinnerembezzleendurefarefeastfoodlunchmealmessmisappropriateomitrefectionrepastsupperswallowtifftommycaulinarycuisinesfoodismmealingmeal mouthedforerunguidanceleadershiptrajectdisplacementgesturejoltmotionmovemovementvibrationwagdrift flowflushglidejetdribblerunrunnyflowsevaporategageimportunejibleapobstructwageflypersistblow flyfleawortfling offflyblownfleyingfliersflingingfliskingflockingflypeflypingflyteflytingflywheelsdriftpiecedriftwindfleenfleetenfly catchingfloatfluctuationknapsackbagbaggylooseparalysisslackswingwattlebecomegatherpluckpretendselectshamstitchswankweavebecomingnessknishknitworkknitchesknittlepilotsprecedecommandhegemonyleadinglead upleadedtinpewterserbmoilcomplygive earhearheedlistensustainbidebrookcopeincurletmaterefraintolerateweatherwithstandbear awaybear downbear down uponbear offbear onbear outbear upbear uponbring to bearforbearingtolewithstanderbearwardenduredsufferstoleratedtoleratingberainingincurtainwithstandingborne in uponswimsuffraganshipsuffragantsuffragatedsuffragatingsuffraginoussuffruticoussuffumigatesubmit togo throughsuffercacuminateflatuscascadedbrizeguidecarry overbears
Idioms with the word ley jaana - لے جانا in it
Idioms related to the meaning of ley jaana - لے جانا
What are the meanings of ley jaana - لے جانا in English?
Meanings of the word ley jaana - لے جانا in English are carry, convey, get, lead, waft, bear and carry over. To understand how would you translate the word ley jaana - لے جانا in English, you can take help from words closely related to ley jaana - لے جانا or it’s English translations. Some of these words can also be considered ley jaana - لے جانا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word ley jaana - لے جانا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use ley jaana - لے جانا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say ley jaana - لے جانا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of ley jaana - لے جانا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by لے جانا?
Meanings of لے جانا are carry, convey, get, lead, waft, bear and carry over
Whats the definition of لے جانا?
Definition of the لے جانا are
- the act of carrying something
- continue or extend
- capture after a fight
- have on the surface or on the skin
- take further or advance
- compensate for a weaker partner or member by one's own performance
- extend to a certain degree
- win approval or support for
- be necessarily associated with or result in or involve
- have or possess something abstract
- keep up with financial support
- have with oneself; have on one's person
- be conveyed over a certain distance
- have as an inherent or characteristic feature or have as a consequence
- include, as on a list
- sing or play against other voices or parts
- serve as a means for expressing something
- pass on a communication
- be successful in
- win in an election
- secure the passage or adoption (of bills and motions)
- cover a certain distance or advance beyond
- have a certain range
- be able to feed
- drink alcohol without showing ill effects
- bear or be able to bear the weight, pressure,or responsibility of
- propel or give impetus to
- bear (a crop)
- include as the content; broadcast or publicize
- pursue a line of scent or be a bearer
- transfer (a number, cipher, or remainder) to the next column or unit's place before or after, in addition or multiplication
- transfer (entries) from one account book to another
- have on hand
- move while supporting, either in a vehicle or in one's hands or on one's body
- support or hold in a certain manner
- contain or hold; have within
- be pregnant with
- transmit or serve as the medium for transmission
- behave in a certain manner
- propel
- be equipped with (a mast or sail)
- serve as a means for expressing something
- transmit or serve as the medium for transmission
- transmit a title or property
- transfer to another
- (of information) make known; pass on
- come into the possession of something concrete or abstract
- reach a destination; arrive by movement or progress
- be a mystery or bewildering to
- cause to do; cause to act in a specified manner
- take the first step or steps in carrying out an action
- be stricken by an illness, fall victim to an illness
- receive a specified treatment (abstract)
- take vengeance on or get even
- receive as a retribution or punishment
- purchase
- acquire as a result of some effort or action
- reach by calculation
- communicate with a place or person; establish communication with, as if by telephone
- cause to move; cause to be in a certain position or condition
- overcome or destroy
- evoke an emotional response
- irritate
- reach and board
- achieve a point or goal
- give certain properties to something
- enter or assume a certain state or condition
- undergo (as of injuries and illnesses)
- leave immediately; used usually in the imperative form
- grasp with the mind or develop an understanding of
- earn or achieve a base by being walked by the pitcher
- go through (mental or physical states or experiences)
- a return on a shot that seemed impossible to reach and would normally have resulted in a point for the opponent
- make (offspring) by reproduction
- preside over
- lead, as in the performance of a composition
- be conducive to
- be in charge of
- the playing of a card to start a trick in bridge
- mixture of graphite with clay in different degrees of hardness; the marking substance in a pencil
- thin strip of metal used to separate lines of type in printing
- an advantage held by a competitor in a race
- evidence pointing to a possible solution
- the introductory section of a story
- a news story of major importance
- (baseball) the position taken by a base runner preparing to advance to the next base
- the angle between the direction a gun is aimed and the position of a moving target (correcting for the flight time of the missile)
- the timing of ignition relative to the position of the piston in an internal-combustion engine
- an indication of potential opportunity
- a jumper that consists of a short piece of wire
- restraint consisting of a rope (or light chain) used to restrain an animal
- an actor who plays a principal role
- tend to or result in
- be ahead of others; be the first
- cause to undertake a certain action
- travel in front of; go in advance of others
- lead, extend, or afford access
- cause something to pass or lead somewhere
- move ahead (of others) in time or space
- stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
- (sports) the score by which a team or individual is winning
- a soft heavy toxic malleable metallic element; bluish white when freshly cut but tarnishes readily to dull grey
- a position of being the initiator of something and an example that others will follow (especially in the phrase take the lead')
- produce as a result or residue
- put up with something or somebody unpleasant
- take on as one's own the expenses or debts of another person
- support or hold in a certain manner
- contain or hold; have within
- be pregnant with
- behave in a certain manner
- have rightfully; of rights, titles, and offices
- bring in
- massive plantigrade carnivorous or omnivorous mammals with long shaggy coats and strong claws
- have on one's person
- cause to be born
- move while holding up or supporting
- an investor with a pessimistic market outlook; an investor who expects prices to fall and so sells now in order to buy later at a lower price
- transfer from one time period to the next
- transfer or persist from one stage or sphere of activity to another
- transport from one place or state to another
- hold over goods to be sold for the next season
- the accumulated and undivided profits of a corporation after provision has been made for dividends and reserves
- application of a skill learned in one situation to a different but similar situation
What is the synonym of لے جانا?
Synonym of word لے جانا are اٹھانا, اُٹھانا, لے جانا, لے چلنا, ڈھونا, پہنچانا, اُٹھا لے جانا, لینا, ملنا, پانا
What are the idioms with the word لے جانا?
Here are the idioms with the word لے جانا in them.
- Jog away jog off
- Fall off
- Go back
- Go under
- Keep good hour
What are the idioms related to لے جانا?
Here are the idioms that are related to the word لے جانا.
- Bear wealth poverty will bear itself
- Many get into a dispute well that cannot get out well
- To get out of one mine to get into another
- Wedlock is like a place besieged those within want to get out those without wish to get in
- Wedlock is like a place besieged; those within want to get out those without wish to get in