chaal - چال meanings in English
chaal - چال meanings in English are tricktrack, walk, trickery, trick, tactic, stratagem, shenanigan, ruse, indirection, crick, frick, trick up, trickment, strick, tricksier, tricklet, riddances, gimme, chal, wieldy, guile, gimmickry, gait, passage, movement, move, motion, manoeuvre, machination, gadget, craft, speed, step, strategy, fashion, deception, deceit, custom, conduct, antic, activity, subterfuge, ceremonial chaal - چال in English. More meanings of chaal - چال, it's definitions, example sentences, related words, idioms and quotations.
tricktrack walk trickery trick tactic stratagem shenanigan ruse indirection crick frick trick up trickment strick tricksier tricklet riddances gimme chal wieldy guile gimmickry gait passage movement move motion manoeuvre machination gadget craft speed step strategy fashion deception deceit custom conduct antic activity subterfuge ceremonial
chaal - چال Definitions
Please find 164 English and 7 Urdu definitions related to the word chaal - چال.
- (noun) : any specific behavior
- (noun) : a formal event performed on a special occasion
- (adjective satellite) : marked by pomp or ceremony or formality
- (verb) : transmit or serve as the medium for transmission
- (verb) : behave in a certain manner
- (noun) : (behavioral attributes) the way a person behaves toward other people
- (verb) : direct the course of; manage or control
- (verb) : lead, as in the performance of a composition
- (verb) : lead musicians in the performance of
- (noun) : manner of acting or controlling yourself
- (noun) : a vehicle designed for navigation in or on water or air or through outer space
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : skill in an occupation or trade
- (noun) : people who perform a particular kind of skilled work
- (noun) : the skilled practice of a practical occupation
- (verb) : make by hand and with much skill
- (noun) : accepted or habitual practice
- (noun) : habitual patronage
- (noun) : a specific practice of long standing
- (noun) : money collected under a tariff
- (adjective) : made according to the specifications of an individual
- (noun) : a person's manner of walking
- (noun) : a horse's manner of moving
- (noun) : a device or control that is very useful for a particular job
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : shrewdness as demonstrated by being skilled in deception
- (noun) : the quality of being crafty
- (noun) : a crafty and involved plot to achieve your (usually sinister) ends
- (noun) : an action aimed at evading an opponent
- (noun) : a move made to gain a tactical end
- (noun) : a deliberate coordinated movement requiring dexterity and skill
- (noun) : a military training exercise
- (noun) : a plan for attaining a particular goal
- (verb) : act in order to achieve a certain goal
- (verb) : perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- (verb) : show, express or direct through movement
- (noun) : the use of movements (especially of the hands) to communicate familiar or prearranged signals
- (noun) : a change of position that does not entail a change of location
- (noun) : the act of changing location from one place to another
- (noun) : a formal proposal for action made to a deliberative assembly for discussion and vote
- (noun) : a state of change
- (noun) : a natural event that involves a change in the position or location of something
- (noun) : an optical illusion of motion produced by viewing a rapid succession of still pictures of a moving object
- (verb) : perform an action, or work out or perform (an action)
- (noun) : a change of position that does not entail a change of location
- (noun) : the act of changing location from one place to another
- (noun) : the act of deciding to do something
- (noun) : the act of changing your residence or place of business
- (verb) : dispose of by selling
- (verb) : live one's life in a specified environment
- (verb) : progress by being changed
- (verb) : propose formally; in a debate or parliamentary meeting
- (verb) : have a turn; make one's move in a game
- (verb) : go or proceed from one point to another
- (verb) : arouse sympathy or compassion in
- (verb) : move so as to change position, perform a nontranslational motion
- (verb) : change residence, affiliation, or place of employment
- (verb) : be in a state of action
- (verb) : follow a procedure or take a course
- (noun) : (game) a player's turn to take some action permitted by the rules of the game
- (verb) : cause to move or shift into a new position or place, both in a concrete and in an abstract sense
- (verb) : change location; move, travel, or proceed, also metaphorically
- (noun) : a series of actions advancing a principle or tending toward a particular end
- (noun) : a general tendency to change (as of opinion)
- (noun) : a change of position that does not entail a change of location
- (noun) : the act of changing location from one place to another
- (noun) : a natural event that involves a change in the position or location of something
- (noun) : an optical illusion of motion produced by viewing a rapid succession of still pictures of a moving object
- (noun) : the act of changing the location of something
- (noun) : the driving and regulating parts of a mechanism (as of a watch or clock)
- (noun) : a major self-contained part of a symphony or sonata
- (noun) : a group of people with a common ideology who try together to achieve certain general goals
- (noun) : a euphemism for defecation
- (noun) : the passing of a law by a legislative body
- (noun) : the act of passing from one state or place to the next
- (noun) : a journey usually by ship
- (noun) : the act of passing something to another person
- (noun) : a way through or along which someone or something may pass
- (noun) : a path or channel or duct through or along which something may pass
- (noun) : a section of text; particularly a section of medium length
- (noun) : a short section of a musical composition
- (noun) : the motion of one object relative to another
- (noun) : a bodily reaction of changing from one place or stage to another
- (noun) : a deceptive maneuver (especially to avoid capture)
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : reckless or malicious behavior that causes discomfort or annoyance in others
- (noun) : a rate (usually rapid) at which something happens
- (verb) : move very fast
- (noun) : changing location rapidly
- (noun) : distance travelled per unit time
- (noun) : a central nervous system stimulant that increases energy and decreases appetite; used to treat narcolepsy and some forms of depression
- (noun) : the ratio of the focal length to the diameter of a (camera) lens system
- (verb) : travel at an excessive or illegal velocity
- (verb) : move hurridly
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : an elaborate and systematic plan of action
- (noun) : the branch of military science dealing with military command and the planning and conduct of a war
- (noun) : a maneuver in a game or conversation
- (noun) : an elaborate or deceitful scheme contrived to deceive or evade
- (noun) : something intended to misrepresent the true nature of an activity
- (noun) : a plan for attaining a particular goal
- (verb) : accompany or escort
- (noun) : (baseball) an advance to first base by a batter who receives four balls
- (noun) : the act of traveling by foot
- (noun) : the act of walking somewhere
- (noun) : a slow gait of a horse in which two feet are always on the ground
- (noun) : a path set aside for walking
- (noun) : manner of walking
- (noun) : careers in general
- (verb) : be or act in association with
- (verb) : live or behave in a specified manner
- (verb) : obtain a base on balls
- (verb) : give a base on balls to
- (verb) : take a walk; go for a walk; walk for pleasure
- (verb) : use one's feet to advance; advance by steps
- (verb) : make walk
- (verb) : traverse or cover by walking
- (verb) : walk at a pace
- (verb) : act as or like a clown
- (adjective satellite) : ludicrously odd
- (noun) : English biochemist who (with Watson in 1953) helped discover the helical structure of DNA (1916-2004)
- (verb) : twist (a body part) into a strained position
- (noun) : a painful muscle spasm especially in the neck or back ( rick' and wrick' are British)
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (noun) : the quality of being fraudulent
- (noun) : an illusory feat; considered magical by naive observers
- (noun) : the act of deceiving
- (noun) : a misleading falsehood
- (verb) : make out of components (often in an improvising manner)
- (noun) : characteristic or habitual practice
- (noun) : consumer goods (especially clothing) in the current mode
- (noun) : the latest and most admired style in clothes and cosmetics and behavior
- (noun) : United States industrialist who amassed a fortune in the steel industry (1849-1919)
- (noun) : a collection of gimmicks
- (noun) : deceitful action that is not straightforward
- (noun) : indirect procedure or action
- (noun) : an illusory feat; considered magical by naive observers
- (verb) : deceive somebody
- (noun) : a prostitute's customer
- (noun) : a cunning or deceitful action or device
- (noun) : an attempt to get you to do something foolish or imprudent
- (noun) : a period of work or duty
- (noun) : (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- (verb) : put on special clothes to appear particularly appealing and attractive
- (noun) : the use of tricks to deceive someone (usually to extract money from them)
- (noun) : verbal misrepresentation intended to take advantage of you in some way
- ایسا پُرزہ جِس کا نام یا تَفصیل معلوم نہ ہو
- جگہ یا رخ بدلنے یا حرکت کا عمل
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
- فنِ حرب اور عمل در آمد کا علم
- حصولِ مقصد کے لیے سوچی سمجھی چال حیلہ
- خصوصاً دشمن کو فریب دینے کے لیے جنگی حکمت عملی
- سلیقے یا ترتیب کے بارے میں یا اس سے متعلق
More words related to the meanings of chaal - چال
More words from English related to chaal - چال
View an extensive list of words below that are related to the meanings of the word chaal - چال meanings in English in English.
accessgangwaygateroutetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmapwentcarrotentranceadmissionegresspassagepassingtravelcommunicationmovementtransportationacerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuity ... asperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpeditenessrapacesfastactlegerdemainacrobaticsartfeatjuggleryperformanceshenaniganskillsleight of handtacticstrickschauntactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitgestmeasurenounoperationpracticeprocedureprocessworkworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresmovemoseysnapmovingnessactivateactuateactuatesagitatejogkedgeactuationarousalencouragement impetusmotivationmotivesuggestionincitementmotationactivityartfulnessmanoeuvrepromptitudequirkinessruseslinessalacritycraftinessdeftnessfoxinessfraudknackmanipulationtacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessearly earlinesscutaneouspost hastequickquicklyrapidskinnydropsyearlyishexpeditiousnesshurriednessjoltyquick wittednessquickyrattailruck uprush offgurgledhadsthaspinghastahastedhastenedhastenshastierhurcheonshurlieshurrayshurrieshurryingsjollifiedjollifiesjollitieslurrymercurizedquickiesrashesrasurerushinesssmurryurgenceurgercompurgationfumacioushastilehastivehurrierincelebritymercurificationraashrashlingscelesticwhurtaffiliatefashionformulatemouldshapeaggregate numberconcurrenceconfluencecontiguitycouplingcounterpartjoinderjoiningjointjunctionlimbmachinationmatchpairpatchseamaccountadditionconnectionconnectednesscontenderinosculationjuncturekinshipknuckleknuckle jointlinklinkagemarrowsolderingsumsuturetotalvampaddlesfoldedjoiningsjointsfolded uplightsomenessalertnessbrisknesspromptnessexpeditewagwalkblewdrive hollohoopimpelmanagemarchrantsnivelbellowinitiateoperaterunstirweepyammerimplateemballair cellcrevice crannyholeleakmortiseopeningborehollowinletmouthvacancyperforatedperforationholesopeningsostiolesairingdiscursiondisport fungarlichomesteadmanoroutingrambleamusementcontentedcontentmentexcursionjauntrecreationsatiatedsatisfiedstrolltiredtripjogglesjogsserrtourconstitutionalwalky talkyoutwalksappliancegatroadwayfaremannerapproach pathestuarialexhausttowing pathestoppagesestopsestrangesestuariesfootwaylanewaypathicpathingroukwayedimposturecircumventiondeceptionguilequackerypearlinessartificecraftcraftyindustrytrademakepreposterouscreationdeceitinstinctintriguenaturesagacitywisdominherencyinnatenessnaturismnatalitiesnatiformnaturesconnaturalityconnaturalnessnaturalitynaturelessnaturitychouscross bitehoaxhypocrisyillusionjuggleshamcheatingdeceivingdouble dealingfallowgriftliemountebankerynetspooftricktrickerywiledelusivewilefuldecededecencedesudationfinfinnavertdislocatedisseat drawobviatewarddetachdrive backmove asiderelieveremoverepelshiftstriketake awaydivergingextrapolaterake offtakedowndetractingdisplacingostiolateremigateremigatingremigationpreemptingbandagecompressfarmgirthholdingligamenligaturetableteachingtenurebandbeltclampdeligationeye washheadbandinklekerseylathlinelistpartplasterpositionrandribbonrowscreedstrapstripstripetabtapethongzonestipestreepputtistripierstripingsstroutyirdedpateestrippetstryphnicbadeedifferentidiosyncraticmarvellousmatchlessoutreputquizzicalqueerstrangeanomalousanticcomicalcrotchetycuriouseccentricnondescriptnoveloff centreonerrumsingularunaccustomeduncommonunfamiliaruniqueunprecedenteduntypicalunusualvagariousuniquelybrandishturnveerwheelwhirlwindbudgemove awaysecedewithdrawcrawlslipbusinesscallingcareerjobmetieroccupationofficeprofessionvocationprodsprooscarryconferconveysendaccompanyconductescortreachtransmitconveyancingconveyingconveyalcautioncustomizecustomizingdirectionguidanceadvicedirectiveinitiativeinjunctioninstructionpreceptdirectingdirectivenessdirectivityguideddirectivesdiremptdiremptiondiremptsguidguidageindirectedceremonialtraditionceremonyformalityhabitudeinstitutelawmodelordinationritualrulewontrit.ritualiseritzyrittersrittingrittsritualizesritziestfilings guiseobservancesandsandsconstitutionusagechargemanagementprovisionlinedardentnesscheattrapblufffeint gimmickmiragemisconceitmisgivingmisguidancemisrepresentationmistakestratagemcatchdelusionfallacyimpositionjapedisloyaltychicanerydouble crossdeceptivenessdeceptivityvitilitigationbetrayalindirectioncircumambulatehoverroamrovecirclerevolverotatetoddleturn roundwanderwobbleyawchurninghang aroundsparringswerveswervingtwistingwhirlingwhirraswirlbesmuttingchauntingchorusingchurningscrimpingfoistingintervolvepervadingroupingspinkstroamingswindlingthirlthirlingtwaddlingtwillingtwingingtwiningtwinkingtwiretwirliesttwirlingvolitatingwaltzingwanderoowandlewaukingwhistingwhomblingwobblierwobblingsembushroching caskstrowlvarkwaterdiversion duplicityhoodwinkingsophistryburnsmakeshifttacticexpediencypolicystrategystrategianstrategicsstrategiesstrategeticalstrategeticsstrategicirculatoryimmobilizeverticitycirculationcyclemisfortunerevolutionvicissitudecircularizationcirculatingcirculativecircumpolarcircitercircuitedcircuitiescircuitycirculablecirculatedcirculatorcircumposeradulatecircinationcircumincessioncircumnutationcircumpositionorbationcircumlocutiondifferenceturningwindingclumpclowndroll jesuitjokerskitwagglebuffooncomedianjesterjocosejokestertomfoolzanycolourcolouringcolordyehuemoodpigmentsuffusedvarnishappearanceaspectchromaenjoymentpaintstyletincttincturevatcolorscoloursdyeshuesarrangementgovernanceorderorganisationmanageabilitymanageablenessforerunleadleadershipguideshipmentoringdictatorapproach patternbehaviorismbehavioristicmodalisticconductorymoralsmorescharacterconductanceconductibilityculerageinvigilanceconfederacyconspiracymisalliancecabalcollusioncomplotconcordplotconcupiscenceconspectusintriguerintriganteconspersionconspicuityconspissationconspireleaguemachinatecolludeframe upconspiringplotteringplottingcontextphraseologydictioninscriptionnarrationwordingcompositionexpressionphrasewordagewritingcoachgaitdepartureexoduscoachwhipkocharmlocksarmorsarmurearmurescoachyconventioncustodiescustomablecustoscustrelscustomarinessconfigurationfiguremodemoraltenorbehaviourchiccuttingdemeanourfoundinggarbposturesituationstancestatevoguemodiusmodussceattevasion ear ring minoroveraboveloftymadultrauponyoungsterbalasballowcruxentanglementgruelimplexionimplicationkinkwater gruelcoilcomplicationconjeecurlcurvedifficultyfoldindirectnessintorsionnullscrewslewtorsiontwistvolutionwimplepaschpatchedpatchingpatchoulyschlockscrewingbachingleachesmatchetspatchespatchingspatchworkspaunchespechpechsperchingpleuchscreaksscreechesscreichscreighscrewerscrewingsscrewsscrowsscutchscutchesspewstachesboltinnlegstagestepcuredeliberationdevicegadgetginopinionplangradualitymaneuverabilitymanoeuvrabilitytacticaltractarianismgradinetactualityplacitorystipulasustulatecriterionmaximbaseetiquette formulahabitmannersestablished orderprincipleregulationcubitdiarrhoeagriphandloose stooldaughtermanufacturetexturecontrivancefittingneebintdiddlehypelurchmisgivemisleadoutwitswindlebafflebamboozlebefoolbeguilebilkbumbazebunkchicanecogdeceivedefrauddeludedodgedupefoolfoxfudgegyphoodwinkjockeynobbleshortshortchangedisplacepostponepush asidedistendenhance enlargegrowlengthenmantlemultiplyoutflyoutnumberoverstepthrivevegetatewaxincreaseknitmountnoseproceedprosperdilemmamazeyawndisplacementgesturejoltvibrationwaftglidegorepairforgoingperveearnestnessfervencypepstirszealdiligenceactivismgettingillationoutcomeproduceconsequencecropdutygainharvestinferenceproceedsproductrealisedresultreturnrevenueattainedattorngetaachievedacquiescesacquiresacquitesattainsattaintedattaintsattornmentavulsedgainedgainsayinggainstgarneredgetteredgettingsgrossedobtainsyieldedattaintmentyieldancedispatchgoingleavesmoothnesscoursingdepartercoursingsdepartersdepartingsdepartsdeparturesdepartableemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressionpaintingpicturestampembowelmentestablishmentsystemismnizamnizamssystemspretextalibicauseexcusemaskpretencesalvostalesubterfugepretexgiveholdcomepacetreadlikewalkstokingtreadingstreadlingprowledprowlsrableback outcirculatedivagatereverbingfaultinessknaverymischiefmischievousnessnaughtinesspranktermagancywaggerywaggishnessbalebamgullimpishnessknavishnessquizrigvicevillainywickednesshumbuginsincerityfictionforeclosureligationbondconstraintlimitationobstructionphraselogyqualmrestrictionclosuredebarmentclosingsclosuresdebarmentsdebarringoutagescloshincloisteroffuscationmodishnesspathwaytechniquebreedingmodus operandithringchurlishimplementmaterialnecessariesapparatusarticlesbaggageequipmentluggagematerielwarebelongingsbagginessburgagecommodoresconsumptsfuggiergugglesluggiepotagespuggareesstuffersstuffierstuffingsstuffstuggingswaresconsignaturewhetstonefootfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsfoot pacefootfallfootstepstridesteedsstetsyardp.a.pafluencyvimtempospeedinesspacesspeansspeedsspeedstersvelocitiesspecesperagestoppagefault gesticulationmotioninggrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloverelationrelevancyloggedisguise quibbletrepanhocusvictimizewheedlemake believevictimiseexpeditionexclamationimprudenceimpesthurtleprotrudeurgebuntjerkkickpokepropelshoveblaizeblowessjugglingsleightprestidigitationplay tricksdesidiousdesidiousnessbeguilementobviationwheyantidotebrachiationbreak evensmash upparbreakparbreakedparbreakssmashesmacrocosmallitrationepigramingenuityquirkuniversaluniversewitworldfibberymachinerymagnificencedecorationdesignequipage framepompsplendourmakingmixturesynthesistemperconstructiondecoctioninventionrecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmanipulatecontrivecountervailformwaitinningopportunitymurderambushphilosophysciencestalediplomacyknowledgewisenessmigrationgenremientontonetypeveinaddictionroutinehabitabilityhabitushabituatesadustionhabiitancyhabilitationhabitaklehabitancehabiturecurrencyoscillatequakequivershaketametrembleditheringfizzingmoldymuckleclowmullingnouldslakingdeathdemisepassing awaytransfersuppressionmeasuresInitiativesmobilitiesjigglejog trotjoggingnudgerspoutingtwig blightgiggedgigginggigglinggigglyjaggingjiggeringjiggingjinkingjockeyingjoggedjoggledjogglingjollingjookingjuggingledgeringloutingnudgingtwiggiertwiggiesttwiggingziggingembulkquallingnavigationvoyagesvoyagecruisesvoyagedprescindclipcutrescinddisceptingdiscapacitatepromenadefuriesprogressedadvanceadvancementaggressionheadwaysprepotencevibratewaverundulateswayingsperambulationpatricidespatrolsaccelerationongoingproceedingagencypragmaticsaffectationbunkumfablefibfrivolous talkairscoquetryflirtingswaggerdamagelosschacmabiographydispositionqualitytraitserrationseuratbiographoleographyserratureserenitudecanoncodeordinancereulewayscoaxinveigleseducediscrepancymesskindmannerismshivahshivahsdismembermentrecisionterraintractdabmopseductionmagicmiraclefrictiongashhackgimmickedgimmickinggimmickyplonkingprocliveumbilicationpushslide
Idioms with the word chaal - چال in it
Idioms related to the meaning of chaal - چال
What are the meanings of chaal - چال in English?
Meanings of the word chaal - چال in English are activity, ceremonial, conduct, craft, custom, gait, gadget, guile, machination, manoeuvre, motion, move, movement, passage, ruse, shenanigan, speed, step, strategy, stratagem, subterfuge, tactic, walk, antic, crick, deceit, deception, fashion, frick, gimmickry, indirection, trick, trick up, trickery, wieldy, chal, gimme, riddances, tricklet, tricksier, strick, trickment and tricktrack. To understand how would you translate the word chaal - چال in English, you can take help from words closely related to chaal - چال or it’s English translations. Some of these words can also be considered chaal - چال synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word chaal - چال. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use chaal - چال in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say chaal - چال in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of chaal - چال with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by چال?
Meanings of چال are activity, ceremonial, conduct, craft, custom, gait, gadget, guile, machination, manoeuvre, motion, move, movement, passage, ruse, shenanigan, speed, step, strategy, stratagem, subterfuge, tactic, walk, antic, crick, deceit, deception, fashion, frick, gimmickry, indirection, trick, trick up, trickery, wieldy, chal, gimme, riddances, tricklet, tricksier, strick, trickment and tricktrack
Whats the definition of چال?
Definition of the چال are
- any specific behavior
- a formal event performed on a special occasion
- marked by pomp or ceremony or formality
- transmit or serve as the medium for transmission
- behave in a certain manner
- (behavioral attributes) the way a person behaves toward other people
- direct the course of; manage or control
- lead, as in the performance of a composition
- lead musicians in the performance of
- manner of acting or controlling yourself
- a vehicle designed for navigation in or on water or air or through outer space
- shrewdness as demonstrated by being skilled in deception
- skill in an occupation or trade
- people who perform a particular kind of skilled work
- the skilled practice of a practical occupation
- make by hand and with much skill
- accepted or habitual practice
- habitual patronage
- a specific practice of long standing
- money collected under a tariff
- made according to the specifications of an individual
- a person's manner of walking
- a horse's manner of moving
- a device or control that is very useful for a particular job
- the use of tricks to deceive someone (usually to extract money from them)
- shrewdness as demonstrated by being skilled in deception
- the quality of being crafty
- a crafty and involved plot to achieve your (usually sinister) ends
- an action aimed at evading an opponent
- a move made to gain a tactical end
- a deliberate coordinated movement requiring dexterity and skill
- a military training exercise
- a plan for attaining a particular goal
- act in order to achieve a certain goal
- perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- show, express or direct through movement
- the use of movements (especially of the hands) to communicate familiar or prearranged signals
- a change of position that does not entail a change of location
- the act of changing location from one place to another
- a formal proposal for action made to a deliberative assembly for discussion and vote
- a state of change
- a natural event that involves a change in the position or location of something
- an optical illusion of motion produced by viewing a rapid succession of still pictures of a moving object
- perform an action, or work out or perform (an action)
- a change of position that does not entail a change of location
- the act of changing location from one place to another
- the act of deciding to do something
- the act of changing your residence or place of business
- dispose of by selling
- live one's life in a specified environment
- progress by being changed
- propose formally; in a debate or parliamentary meeting
- have a turn; make one's move in a game
- go or proceed from one point to another
- arouse sympathy or compassion in
- move so as to change position, perform a nontranslational motion
- change residence, affiliation, or place of employment
- be in a state of action
- follow a procedure or take a course
- (game) a player's turn to take some action permitted by the rules of the game
- cause to move or shift into a new position or place, both in a concrete and in an abstract sense
- change location; move, travel, or proceed, also metaphorically
- a series of actions advancing a principle or tending toward a particular end
- a general tendency to change (as of opinion)
- a change of position that does not entail a change of location
- the act of changing location from one place to another
- a natural event that involves a change in the position or location of something
- an optical illusion of motion produced by viewing a rapid succession of still pictures of a moving object
- the act of changing the location of something
- the driving and regulating parts of a mechanism (as of a watch or clock)
- a major self-contained part of a symphony or sonata
- a group of people with a common ideology who try together to achieve certain general goals
- a euphemism for defecation
- the passing of a law by a legislative body
- the act of passing from one state or place to the next
- a journey usually by ship
- the act of passing something to another person
- a way through or along which someone or something may pass
- a path or channel or duct through or along which something may pass
- a section of text; particularly a section of medium length
- a short section of a musical composition
- the motion of one object relative to another
- a bodily reaction of changing from one place or stage to another
- a deceptive maneuver (especially to avoid capture)
- the use of tricks to deceive someone (usually to extract money from them)
- reckless or malicious behavior that causes discomfort or annoyance in others
- a rate (usually rapid) at which something happens
- move very fast
- changing location rapidly
- distance travelled per unit time
- a central nervous system stimulant that increases energy and decreases appetite; used to treat narcolepsy and some forms of depression
- the ratio of the focal length to the diameter of a (camera) lens system
- travel at an excessive or illegal velocity
- move hurridly
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- an elaborate and systematic plan of action
- the branch of military science dealing with military command and the planning and conduct of a war
- a maneuver in a game or conversation
- an elaborate or deceitful scheme contrived to deceive or evade
- something intended to misrepresent the true nature of an activity
- a plan for attaining a particular goal
- accompany or escort
- (baseball) an advance to first base by a batter who receives four balls
- the act of traveling by foot
- the act of walking somewhere
- a slow gait of a horse in which two feet are always on the ground
- a path set aside for walking
- manner of walking
- careers in general
- be or act in association with
- live or behave in a specified manner
- obtain a base on balls
- give a base on balls to
- take a walk; go for a walk; walk for pleasure
- use one's feet to advance; advance by steps
- make walk
- traverse or cover by walking
- walk at a pace
- act as or like a clown
- ludicrously odd
- English biochemist who (with Watson in 1953) helped discover the helical structure of DNA (1916-2004)
- twist (a body part) into a strained position
- a painful muscle spasm especially in the neck or back ( rick' and wrick' are British)
- the act of deceiving
- a misleading falsehood
- the quality of being fraudulent
- an illusory feat; considered magical by naive observers
- the act of deceiving
- a misleading falsehood
- make out of components (often in an improvising manner)
- characteristic or habitual practice
- consumer goods (especially clothing) in the current mode
- the latest and most admired style in clothes and cosmetics and behavior
- United States industrialist who amassed a fortune in the steel industry (1849-1919)
- a collection of gimmicks
- deceitful action that is not straightforward
- indirect procedure or action
- an illusory feat; considered magical by naive observers
- deceive somebody
- a prostitute's customer
- a cunning or deceitful action or device
- an attempt to get you to do something foolish or imprudent
- a period of work or duty
- (card games) in a single round, the sequence of cards played by all the players; the high card is the winner
- put on special clothes to appear particularly appealing and attractive
- the use of tricks to deceive someone (usually to extract money from them)
- verbal misrepresentation intended to take advantage of you in some way
- ایسا پُرزہ جِس کا نام یا تَفصیل معلوم نہ ہو
- جگہ یا رخ بدلنے یا حرکت کا عمل
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
- فنِ حرب اور عمل در آمد کا علم
- حصولِ مقصد کے لیے سوچی سمجھی چال حیلہ
- خصوصاً دشمن کو فریب دینے کے لیے جنگی حکمت عملی
- سلیقے یا ترتیب کے بارے میں یا اس سے متعلق
What is the synonym of چال?
Synonym of word چال are با عمل, مُتحَرک ہونے کی صُورت حال, قویٰ سے کام لینا, زور دار کاروائی, پھرتی, چال, سرگرمی, پیش قدمی, عملیت, رسم
What are the idioms with the word چال?
Here are the idioms with the word چال in them.
- Agues come on horseback but go away on foot
- Ill comes in by ells and goes out by inches
- Misfortunes come on wings and depart on foot
- Change the leg
- One barking dog sets all the street a barking
What are the idioms related to چال?
Here are the idioms that are related to the word چال.
- Step after step the ladder is ascended
- Step by step one goes far
- Pincer movement
- Bird of passage
- Galvanize into activity