dag - ڈگ meanings in English
dag - ڈگ Definitions
Please find 33 English and 2 Urdu definitions related to the word dag - ڈگ.
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : musical notation for a repeating pattern of musical beats
- (noun) : a statute in draft before it becomes law
- (noun) : a basis for comparison; a reference point against which other things can be evaluated
- (verb) : express as a number or measure or quantity
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : how much there is or how many there are of something that you can quantify
- (noun) : the act or process of assigning numbers to phenomena according to a rule
- (noun) : a container of some standard capacity that is used to obtain fixed amounts of a substance
- (verb) : have certain dimensions
- (verb) : evaluate or estimate the nature, quality, ability, extent, or significance of
- (noun) : measuring instrument having a sequence of marks at regular intervals; used as a reference in making measurements
- (verb) : determine the measurements of something or somebody, take measurements of
- (verb) : cover or traverse by taking long steps
- (verb) : walk with long steps
- (noun) : significant progress (especially in the phrase make strides')
- چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words related to the meanings of dag - ڈگ
More words from English related to dag - ڈگ
View an extensive list of words below that are related to the meanings of the word dag - ڈگ meanings in English in English.
actactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitfeatgestmeasurenounoperationpracticeprocedureprocessworkworkingactuationsadherencesenactionsimplementsimpletionimpletionsprocessesprosesadactproceresappraiseestimateevaluategaugevaluejudgevaluateceremonialcraftgadgetmachinationmanoeuvremovemovementpassagespeed ... stepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcruxdifficultyinnjourneylegstageemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentfaregiveholdmakemarchcomegooperatepaceproceedruntreadlikewalkstokingtreadingstreadlingfootfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsfoot pacefootfallfootstepstridesteedsstetsyardp.a.paseasongrobianpendstempovelocityspeedinesspacesspeansspeedsspeedstersvelocitiesspecesperagemodelcupmeterquantityquartscaleyardstickscaleyguessopinionsurmisesuppositionconjecturejudgementmensurationspeciatesupposalsupposititiousproemssupposingsimportancerhythmemphasishefthonourloadmetrerhymeweightweightinessweightingweenedweensweighageweighagesweighbaukweighingsweightingsweightswelshedweerishwexjumpleaphopjump overvaultsuppressionmeasuresInitiativesquantify
Idioms related to the meaning of dag - ڈگ
What are the meanings of dag - ڈگ in English?
Meanings of the word dag - ڈگ in English are foot pace, pace, step, measure and stride. To understand how would you translate the word dag - ڈگ in English, you can take help from words closely related to dag - ڈگ or it’s English translations. Some of these words can also be considered dag - ڈگ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word dag - ڈگ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use dag - ڈگ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say dag - ڈگ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of dag - ڈگ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by ڈگ?
Meanings of ڈگ are foot pace, pace, step, measure and stride
Whats the definition of ڈگ?
Definition of the ڈگ are
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- musical notation for a repeating pattern of musical beats
- a statute in draft before it becomes law
- a basis for comparison; a reference point against which other things can be evaluated
- express as a number or measure or quantity
- any maneuver made as part of progress toward a goal
- how much there is or how many there are of something that you can quantify
- the act or process of assigning numbers to phenomena according to a rule
- a container of some standard capacity that is used to obtain fixed amounts of a substance
- have certain dimensions
- evaluate or estimate the nature, quality, ability, extent, or significance of
- measuring instrument having a sequence of marks at regular intervals; used as a reference in making measurements
- determine the measurements of something or somebody, take measurements of
- cover or traverse by taking long steps
- walk with long steps
- significant progress (especially in the phrase make strides')
- چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of ڈگ?
Synonym of word ڈگ are ڈگ, قدم, گام, پینڈ, چلنے یا بھاگنے کا ایک قدم, چلنا, قدم ناپنا, سنبھل سنبھل کر چلنا, خرام, رفتار
What are the idioms related to ڈگ?
Here are the idioms that are related to the word ڈگ.
- Step after step the ladder is ascended
- Step by step one goes far
- At a snail pace
- Force and pace
- Ill news comes at a pace