Chalna - چلنا meanings in English

Chalna - چلنا meanings in English are fare, treadings, stoking, likewalk, tread, run, proceed, pace, operate, go, come, walk, move, march, make, journey, hold, give, treadling Chalna - چلنا in English. More meanings of chalna - چلنا, it's definitions, example sentences, related words, idioms and quotations.

fare treadings stoking likewalk tread run proceed pace operate go come walk move march make journey hold give treadling

Install chrome extension

Chalna - چلنا Definitions

Please find 313 English and 2 Urdu definitions related to the word Chalna - چلنا.

  • (verb) : reach a destination; arrive by movement or progress
  • (verb) : experience orgasm
  • (verb) : develop into
  • (verb) : extend or reach
  • (verb) : exist or occur in a certain point in a series
  • (verb) : come to pass; arrive, as in due course
  • (verb) : be found or available
  • (verb) : happen as a result
  • (verb) : have a certain priority
  • (verb) : cover a certain distance
  • (verb) : move toward, travel toward something or somebody or approach something or somebody
  • (verb) : be received
  • (verb) : come under, be classified or included
  • (verb) : come from; be connected by a relationship of blood, for example
  • (verb) : be a native of
  • (verb) : come forth
  • (verb) : come to one's mind; suggest itself
  • (noun) : the thick white fluid containing spermatozoa that is ejaculated by the male genital tract
  • (verb) : reach or enter a state, relation, condition, use, or position
  • (noun) : a paying (taxi) passenger
  • (noun) : the sum charged for riding in a public conveyance
  • (noun) : an agenda of things to do
  • (verb) : eat well
  • (noun) : the food and drink that are regularly served or consumed
  • (verb) : be the cause or source of
  • (verb) : give or convey physically
  • (verb) : break down, literally or metaphorically
  • (verb) : give entirely to a specific person, activity, or cause
  • (verb) : contribute to some cause
  • (verb) : give food to
  • (verb) : give or supply
  • (verb) : give as a present; make a gift of
  • (noun) : the elasticity of something that can be stretched and returns to its original length
  • (verb) : transfer possession of something concrete or abstract to somebody
  • (verb) : leave with; give temporarily
  • (verb) : convey or reveal information
  • (verb) : give (as medicine)
  • (verb) : cause to have, in the abstract sense or physical sense
  • (verb) : deliver in exchange or recompense
  • (verb) : emit or utter
  • (verb) : execute and deliver
  • (verb) : estimate the duration or outcome of something
  • (verb) : dedicate
  • (verb) : inflict as a punishment
  • (verb) : allow to have or take
  • (verb) : guide or direct, as by behavior of persuasion
  • (verb) : submit for consideration, judgment, or use
  • (verb) : offer in good faith
  • (verb) : manifest or show
  • (verb) : convey or communicate; of a smile, a look, a physical gesture
  • (verb) : convey, as of a compliment, regards, attention, etc.; bestow
  • (verb) : bestow
  • (verb) : proffer (a body part)
  • (verb) : consent to engage in sexual intercourse with a man
  • (verb) : propose
  • (verb) : be flexible under stress of physical force
  • (verb) : perform for an audience
  • (verb) : present to view
  • (verb) : bestow, especially officially
  • (verb) : endure the loss of
  • (verb) : move in order to make room for someone for something
  • (verb) : organize or be responsible for
  • (verb) : place into the hands or custody of
  • (verb) : accord by verdict
  • (verb) : cause to happen or be responsible for
  • (verb) : transmit (knowledge or skills)
  • (verb) : have room for; hold without crowding
  • (verb) : be pertinent or relevant or applicable
  • (noun) : understanding of the nature or meaning or quality or magnitude of something
  • (verb) : cause to stop
  • (verb) : drink alcohol without showing ill effects
  • (verb) : support or hold in a certain manner
  • (verb) : contain or hold; have within
  • (verb) : lessen the intensity of; temper; hold in restraint; hold or keep within limits
  • (noun) : the act of grasping
  • (verb) : be capable of holding or containing
  • (verb) : maintain (a theory, thoughts, or feelings)
  • (verb) : organize or be responsible for
  • (noun) : the appendage to an object that is designed to be held in order to use or move it
  • (verb) : protect against a challenge or attack
  • (noun) : a cell in a jail or prison
  • (noun) : a stronghold
  • (noun) : power by which something or someone is affected or dominated
  • (noun) : a state of being confined (usually for a short time)
  • (noun) : time during which some action is awaited
  • (noun) : the space in a ship or aircraft for storing cargo
  • (verb) : take and maintain control over, often by violent means
  • (verb) : keep from departing
  • (verb) : stop dealing with
  • (verb) : remain in a certain state, position, or condition
  • (verb) : have as a major characteristic
  • (verb) : remain committed to
  • (verb) : assert or affirm
  • (verb) : hold the attention of
  • (verb) : keep from exhaling or expelling
  • (verb) : aim, point, or direct
  • (verb) : have or hold in one's hands or grip
  • (verb) : be the physical support of; carry the weight of
  • (verb) : cover as for protection against noise or smell
  • (verb) : secure and keep for possible future use or application
  • (verb) : have rightfully; of rights, titles, and offices
  • (verb) : arrange for and reserve (something for someone else) in advance
  • (verb) : be valid, applicable, or true
  • (verb) : keep in mind or convey as a conviction or view
  • (verb) : have or possess, either in a concrete or an abstract sense
  • (verb) : resist or confront with resistance
  • (verb) : declare to be
  • (verb) : to close within bounds, or otherwise limit or deprive of free movement
  • (verb) : cause to continue in a certain state, position, or activity; e.g., keep clean'
  • (noun) : the act of traveling from one place to another
  • (verb) : undertake a journey or trip
  • (verb) : travel upon or across
  • (verb) : make by combining materials and parts
  • (verb) : cause to do; cause to act in a specified manner
  • (verb) : earn on some commercial or business transaction; earn as salary or wages
  • (verb) : develop into
  • (verb) : create by artistic means
  • (verb) : make or cause to be or to become
  • (verb) : perform or carry out
  • (verb) : make, formulate, or derive in the mind
  • (verb) : institute, enact, or establish
  • (verb) : reach a destination, either real or abstract
  • (verb) : achieve a point or goal
  • (verb) : give certain properties to something
  • (verb) : organize or be responsible for
  • (noun) : a recognizable kind
  • (verb) : proceed along a path
  • (verb) : appear to begin an activity
  • (verb) : carry out or commit
  • (verb) : form by assembling individuals or constituents
  • (verb) : constitute the essence of
  • (verb) : amount to
  • (verb) : be or be capable of being changed or made into
  • (verb) : put in order or neaten
  • (verb) : add up to
  • (verb) : be suitable for
  • (verb) : undergo fabrication or creation
  • (verb) : change from one form into another
  • (verb) : favor the development of
  • (verb) : cause to be enjoyable or pleasurable
  • (verb) : calculate as being
  • (verb) : consider as being
  • (verb) : eliminate urine
  • (verb) : represent fictitiously, as in a play, or pretend to be or act like
  • (verb) : assure the success of
  • (verb) : behave in a certain way
  • (verb) : act in a certain way so as to acquire
  • (verb) : compel or make somebody or something to act in a certain way
  • (verb) : make by shaping or bringing together constituents
  • (verb) : gather and light the materials for
  • (verb) : head into a specified direction
  • (verb) : charge with a function; charge to be
  • (verb) : reach a goal
  • (verb) : to compose or represent
  • (noun) : the month following February and preceding April
  • (noun) : a steady advance
  • (noun) : the act of marching; walking with regular steps (especially in a procession of some kind)
  • (noun) : a procession of people walking together
  • (noun) : a degree granted for the successful completion of advanced study of architecture
  • (noun) : genre of music written for marching
  • (noun) : district consisting of the area on either side of a border or boundary of a country or an area
  • (verb) : force to march
  • (verb) : cause to march or go at a marching pace
  • (verb) : walk fast, with regular or measured steps; walk with a stride
  • (verb) : march in a procession
  • (verb) : march in protest; take part in a demonstration
  • (verb) : walk ostentatiously
  • (verb) : perform an action, or work out or perform (an action)
  • (noun) : a change of position that does not entail a change of location
  • (noun) : the act of changing location from one place to another
  • (noun) : the act of deciding to do something
  • (noun) : the act of changing your residence or place of business
  • (verb) : dispose of by selling
  • (verb) : live one's life in a specified environment
  • (verb) : progress by being changed
  • (verb) : propose formally; in a debate or parliamentary meeting
  • (verb) : have a turn; make one's move in a game
  • (verb) : go or proceed from one point to another
  • (verb) : arouse sympathy or compassion in
  • (verb) : move so as to change position, perform a nontranslational motion
  • (verb) : change residence, affiliation, or place of employment
  • (verb) : be in a state of action
  • (verb) : follow a procedure or take a course
  • (noun) : (game) a player's turn to take some action permitted by the rules of the game
  • (verb) : cause to move or shift into a new position or place, both in a concrete and in an abstract sense
  • (verb) : change location; move, travel, or proceed, also metaphorically
  • (verb) : keep engaged
  • (verb) : perform as expected when applied
  • (verb) : perform a movement in military or naval tactics in order to secure an advantage in attack or defense
  • (verb) : direct or control; projects, businesses, etc.
  • (verb) : handle and cause to function
  • (verb) : perform surgery on
  • (verb) : be diffused
  • (verb) : flee; take to one's heels; cut and run
  • (verb) : include as the content; broadcast or publicize
  • (noun) : a race between candidates for elective office
  • (verb) : run, stand, or compete for an office or a position
  • (verb) : keep company
  • (verb) : move along, of liquids
  • (verb) : continue to exist
  • (verb) : perform as expected when applied
  • (verb) : pursue for food or sport (as of wild animals)
  • (verb) : cause something to pass or lead somewhere
  • (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • (verb) : have a tendency or disposition to do or be something; be inclined
  • (verb) : progress by being changed
  • (verb) : direct or control; projects, businesses, etc.
  • (verb) : compete in a race
  • (noun) : a row of unravelled stitches
  • (verb) : change or be different within limits
  • (noun) : a small stream
  • (noun) : a score in baseball made by a runner touching all four bases safely
  • (noun) : the act of running; traveling on foot at a fast pace
  • (noun) : a regular trip
  • (noun) : a short trip
  • (noun) : an unbroken chronological sequence
  • (noun) : the production achieved during a continuous period of operation (of a machine or factory etc.)
  • (noun) : unrestricted freedom to use
  • (noun) : the continuous period of time during which something (a machine or a factory) operates or continues in operation
  • (noun) : an unbroken series of events
  • (noun) : the act of testing something
  • (noun) : a race run on foot
  • (verb) : cause an animal to move fast
  • (verb) : move about freely and without restraint, or act as if running around in an uncontrolled way
  • (verb) : deal in illegally, such as arms or liquor
  • (verb) : set animals loose to graze
  • (verb) : make without a miss
  • (verb) : carry out a process or program, as on a computer or a machine
  • (verb) : occur persistently
  • (verb) : extend or continue for a certain period of time
  • (verb) : be affected by; be subjected to
  • (verb) : have a particular form
  • (verb) : become undone
  • (verb) : cause to perform
  • (verb) : change from one state to another
  • (verb) : be operating, running or functioning
  • (verb) : carry out
  • (verb) : cover by running; run a certain distance
  • (verb) : move fast by using one's feet, with one foot off the ground at any given time
  • (verb) : travel rapidly, by any (unspecified) means
  • (verb) : run with the ball; in such sports as football
  • (verb) : sail before the wind
  • (verb) : come unraveled or undone as if by snagging
  • (verb) : reduce or cause to be reduced from a solid to a liquid state, usually by heating
  • (noun) : (American football) a play in which a player attempts to carry the ball through or past the opposing team
  • (verb) : cause to emit recorded audio or video
  • (verb) : pass over, across, or through
  • (verb) : accompany or escort
  • (noun) : (baseball) an advance to first base by a batter who receives four balls
  • (noun) : the act of traveling by foot
  • (noun) : the act of walking somewhere
  • (noun) : a slow gait of a horse in which two feet are always on the ground
  • (noun) : a path set aside for walking
  • (noun) : manner of walking
  • (noun) : careers in general
  • (verb) : be or act in association with
  • (verb) : live or behave in a specified manner
  • (verb) : obtain a base on balls
  • (verb) : give a base on balls to
  • (verb) : take a walk; go for a walk; walk for pleasure
  • (verb) : use one's feet to advance; advance by steps
  • (verb) : make walk
  • (verb) : traverse or cover by walking
  • (verb) : walk at a pace
  • (verb) : blend or harmonize
  • (verb) : stop operating or functioning
  • (noun) : a usually brief attempt
  • (noun) : street names for methylenedioxymethamphetamine
  • (verb) : be the right size or shape; fit correctly or as desired
  • (verb) : perform as expected when applied
  • (verb) : enter or assume a certain state or condition
  • (verb) : lead, extend, or afford access
  • (verb) : stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • (verb) : progress by being changed
  • (verb) : have a turn; make one's move in a game
  • (verb) : follow a procedure or take a course
  • (verb) : give support (to) or make a choice (of) one out of a group or number
  • (verb) : have a particular form
  • (verb) : be in the right place or situation
  • (verb) : pass from physical life and lose all bodily attributes and functions necessary to sustain life
  • (verb) : move away from a place into another direction
  • (verb) : begin or set in motion
  • (verb) : follow a certain course
  • (verb) : be abolished or discarded
  • (verb) : to be spent or finished
  • (verb) : be spent
  • (verb) : make a certain noise or sound
  • (verb) : be or continue to be in a certain condition
  • (verb) : be contained in
  • (verb) : be ranked or compare
  • (adjective) : functioning correctly and ready for action
  • (verb) : continue to live and avoid dying
  • (noun) : a board game for two players who place counters on a grid; the object is to surround and so capture the opponent's counters
  • (noun) : a time period for working (after which you will be relieved by someone else)
  • (verb) : go through in search of something; search through someone's belongings in an unauthorized way
  • (verb) : change location; move, travel, or proceed, also metaphorically
  • (verb) : pass, fare, or elapse; of a certain state of affairs or action
  • (verb) : be awarded; be allotted
  • (verb) : be sounded, played, or expressed
  • (verb) : continue a certain state, condition, or activity
  • (verb) : move ahead; travel onward in time or space
  • (verb) : follow a procedure or take a course
  • (verb) : continue talking
  • (verb) : follow a certain course
  • (verb) : mate with
  • (verb) : put down or press the foot, place the foot
  • (verb) : tread or stomp heavily or roughly
  • (noun) : structural member consisting of the horizontal part of a stair or step
  • (noun) : the part (as of a wheel or shoe) that makes contact with the ground
  • (noun) : the grooved surface of a pneumatic tire
  • (verb) : brace (an archer's bow) by pressing the foot against the center
  • (verb) : crush as if by treading on
  • (verb) : apply (the tread) to a tire
  • کِسی نُقطے يا مَرحَلے پَر پَہُنچ جانا
  • چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ

More words related to the meanings of Chalna - چلنا

Comeپَہُنچنا Pohuncha آنا aana آنا ana آنا چلنا chalna آ جانا aa jaana تشریف لانا tashriif laana
Fareراستہ raastah راستہ Rasta سدھارنا sudhaarna کھانا khaana کھانا Khana ڈگرنا Dagarna جانا jaana جانا Jana چلنا chalna رمنا Ramna پھرنا phirna گزرنا guzarna سفر یا سیر کرنا بھاڑا Bhaara کرایہ kiraayah کرایہ Kiraya اترائی Itraai اترائی Itraayi کھوائی Khuwai اجورہ Ajoora ملاحی Malahi کہاری کوڑی کامیاب ہونا kaam yaab hona کامیاب ہونا kaamyaab hona سفر کرنا safar karna مسافر musaafir مسافر Musafir کھانا کھلانا khaana khilaana کسی حال میں ہونا kisi haal meyn hona
Giveٹوٹنا tuutna ٹوٹنا Tootna دینا deyna دینا dunya دینا Dena بخشنا bakhshna بخشنا baklhshna مرحمت کرنا عطا کرنا ata karna عطا کرنا ataa karna چلنا chalna عنایت کرنا enaayat karna کھسنا Kahasna دان کرنا پن کرنا عنایت کرنا ênaayat پکڑانا pakraana پھل دینا phal deyna
Holdماننا maanna رکھنا rakhna پکڑنا pakarna تھمو Thamo پکڑ pakar پکڑ Pakarh پکڑ Pakad تھامنا thaamna منانا manaana منانا Manana قبضہ qabzah قبضہ Qabza رہنا rahina رہنا raehna رہنا Rehna چلنا chalna ٹھیرنا thaerna ٹھیرنا Thairna ٹکنا tikna ٹکنا tikana گرفت کرنا گرفت giraft قابو qaabu قابو Qaboo قابو Qabu مٹھیانا Muthiyana تھام Thaam ٹھیرو Thero چپ رہو بس کرو ہونا hona سادھنا saadhna سدھانا sadhaana سدھانا Sudhana تھمانا thamaana
Journeyراہ raah راہ Rah دورہ daurah دورہ Doura کوچ kuuch کوچ Koch مرحلہ marhalah مرحلہ Marhala چلنا chalna منزل manzil سفر safar مسافرت Musafirat سیاحت seyaahat سیاحت saiyaahat سیاحت Sayyahat سفر کرنا safar karna ایک دن کا کام eyk din ka kaam سیر سپاٹا saer sapaata
Makeکرنا karna کرنا krna بناوٹ banaawat بناوٹ bunaawat بناوٹ Banawat ساخت saakht بنانا banaana پیدا کرنا paeda karna صورت surat صورت suurat صورت Soorat شکل shakl شکل Shakal ڈول daul ڈول dol ڈول Dowl فطرت fitrat ساز saaz تراش taraash تراش Tarash مزاج mizaaj جھکنا jhukna اپجانا Upjana چلنا chalna تیار کرنا taiyaar karna تیار کرنا taiyyaar karna تیار کرنا taiyyar karna ڈھنگ dhang وضع قطع waza qata ترکیب tarkiib ترکیب Tarkib ترکیب Tarqeeb پرکار par kaar پرکار Parkaar حبثہ Habsa حبثہ Hubsa اندام andaam قویٰ کاٹھی صنعت sanat صنعت Sana'at صنعت Sanaat تراش خراش taraash kharaash سرشت sarisht افتاد طبع راغب ہونا آگے بڑھنا aagey barhna ہستی میں لانا مخلوق کرنا ات پتی کرنا اُگانا
Marchحد had حد Hadd چلانا chillaana چلانا chalaana چلانا Chalana لے چلنا کوچ kuuch کوچ Koch بڑھنا barhna بڑھنا Badhna روانہ کرنا rawaanah karna روانگی rawaangi چل دینا chal deyna چلنا chalna سرحد sar had سرحد Sarhad گمن Guman مارچ March انگریزی تیسرا مہینہ پھاگن چیت قدم بقدم چلنا ڈگ بھرنا dag bharna کوچ کرنا kuuch karna روانہ ہونا rawaanah hona ڈیرا ڈنڈا اٹھانا باقاعدہ قدم اٹھانا معین رفتار سے چلنا مارچ کرنا در بدر کرنا dar badar karna سرحدی علاقہ êlaaqah بہ قطار چلنا bah qataar chalna فوجی انداز سے چلنا fauji andaaz sey chalna سرحدی علاقہ sar hadi elaaqah
Moveحرکت کرنا harkat karna حرکت دینا harkat deyna ڈلانا Dalana چلانا chillaana چلانا chalaana چلانا Chalana ہٹانا hataana ہٹانا Hatana ہٹنا hatna سرکنا Sarakna چال chaal سرکانا sarkaana سرکانا Sarkana بڑھنا barhna بڑھنا Badhna جنبش junbish چلنا chalna حرکت harkat حرکت Harkut حرکت Hurkat دھکیلنا dhakelna دھکیلنا dhakeylna ہلنا hilna ہلچل میں ہونا انتقال inteqaal اقدام aqdaam اقدام eqdaam اقدام Iqdaam عملی قدم تحریک کرنا ہٹا لے جانا آگے کو بڑھانا جنبش دینا junbish deyna کاروائ kaar rawaa i چال چلنا chaal chalna کھسکانا khiskaana اٹھا کر لے جانا utha kar ley jaana
Operateپورا کرنا puura karna کرنا karna کرنا krna چلانا chillaana چلانا chalaana چلانا Chalana چلنا chalna تاثیر یا نقش کرنا چالو ہونا chaaluu hona عمل کرنا aamal karna عمل کرنا amal karna عمل کرنا amal kara جراحی کرنا jarrahi karna
Paceچلنا chalna قدم qadam ڈگ dag گام gaam رفتار raftaar چلنے یا بھاگنے کا ایک قدم خرام khiraam خرام Kharam قدم ناپنا qadam naapna سنبھل سنبھل کر چلنا sanbhal sanbhal kar chalna
Runچلانا chillaana چلانا chalaana چلانا Chalana دوڑنا daurna دوڑنا Dorna بہنا baehna بہنا Behna بھاگنا bhaagna بھاگنا Bhegana چلنا chalna تيز تيز چَلنا لپکنا lapakna لپکانا lapkaana رَن رپٹنا rapatna بھگانا bhagaana بھگانا bhigaana دوڑانا dauraana رپٹانا raptaana
Walkڈلانا Dalana چلانا chillaana چلانا chalaana چلانا Chalana سیر saer سیر seyr سیر Sair چہل قدمی chahel qadmi راستہ raastah راستہ Rasta پھرانا phiraana پھرانا Phirana چال chaal گھومنا ghuumna گھومنا Ghoomna جانا jaana جانا Jana چلنا chalna پھرنا phirna رفتار raftaar ٹہلنا tahelna چہل قدمی کرنا chahel qadmi karna روش rawish ڈولنا dolna گشت gasht گشت Gusht گل گشت مشی Mishi گل گشت کرنا قدم قدم ٹہلانا Tehlana پاؤں اٹھنا paa on uthna
Goجاؤ jaa o جاؤ Jao جانا jaana جانا Jana چلنا chalna جایئے jaa iey
Proceedبڑھنا barhna بڑھنا Badhna چلنا chalna آگے بڑھنا aagey barhna آغاز ہونا aaghaaz hona قدم بڑھانا qadam barhaana
Treadسراغ suraagh چلنا chalna قدم اٹھانا qadam uthaana قدم کا نشان qadam ka nishaan پاؤں سے کچلنا paa on sey kuchalna
Likewalkچلنا chalna
Stokingچلنا chalna
Treadingsچلنا chalna
Treadlingچلنا chalna

More words from English related to Chalna - چلنا

View an extensive list of words below that are related to the meanings of the word Chalna - چلنا meanings in English in English.

accedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateaccessgangwaygateroutetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmap ...

Idioms related to the meaning of Chalna - چلنا

Englishاردو
To operateاثر کرنا
You will proceed most safely by the middle couresسلامتی میانہروی میں ہی ہے
March pastمارچ پاسٹ
Rogue marchنکالے جانے والے شخص کی تحقیر میں بچایا جانے والی موسیقی
If you tell every step you will make a long journeyگن گن کر قدم رکھو گے تو سفر ختم ہو چکا
Make a moveجانا
At a snail paceبہت آہستہ
Force and paceرفتار تیز رکھنا
Ill news comes at a paceبری خبر جلد پھیل جاتی ہے
At a snails paceبہت آہستہ
After dinner sit a while after supper walk a mileصُبح کے کھانے کے بعد آرام شام کے کھانے کے بعد سیر صحت کے لیے مُفید ہے
He that has a head of wax must not walk in the sunدُشمن سے کمزوری چھپاوٴ
Religion lies more in walk than in talkمذہب زبانی جمع خرچ کی چیز نہیں
Walk offچھوڑنا
Walk outباہر چلے جانا
You walk upon flames covered by treacherous ashesاس جگہ خطرہ پنہاں ہے دیکھ بھال کر قدم رکھنا
After dinner sit a while; after supper walk a mileصُبح کے کھانے کے بعد آرام شام کے کھانے کے بعد سیر صحت کے لیے مُفید ہے
A journey of a thousand miles begins with one stepبڑے بڑے کاموں کا آغاز بھی بہت چھوٹا ہوتا ہے
For a morning rain leave not your journeyذرا سی مُشکل سے گھبرا نہ جاوٴ
From poverty to wealth is a troublesome journey but the way back is easyروپیہ کمانا مشکل ہے لٹانا آسان ہے
View More ...

What are the meanings of Chalna - چلنا in English?

Meanings of the word Chalna - چلنا in English are come, fare, give, hold, journey, make, march, move, operate, pace, run, walk, go, proceed, tread, likewalk, stoking, treadings and treadling. To understand how would you translate the word Chalna - چلنا in English, you can take help from words closely related to Chalna - چلنا or it’s English translations. Some of these words can also be considered Chalna - چلنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word Chalna - چلنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use Chalna - چلنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.

We have tried our level best to provide you as much detail on how to say Chalna - چلنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of Chalna - چلنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.

Frequently Asked Questions (FAQ)

What do you mean by chalna?

Meanings of chalna are come, fare, give, hold, journey, make, march, move, operate, pace, run, walk, go, proceed, tread, likewalk, stoking, treadings and treadling

Whats the definition of chalna?

Definition of the chalna are

  • reach a destination; arrive by movement or progress
  • experience orgasm
  • develop into
  • extend or reach
  • exist or occur in a certain point in a series
  • come to pass; arrive, as in due course
  • be found or available
  • happen as a result
  • have a certain priority
  • cover a certain distance
  • move toward, travel toward something or somebody or approach something or somebody
  • be received
  • come under, be classified or included
  • come from; be connected by a relationship of blood, for example
  • be a native of
  • come forth
  • come to one's mind; suggest itself
  • the thick white fluid containing spermatozoa that is ejaculated by the male genital tract
  • reach or enter a state, relation, condition, use, or position
  • a paying (taxi) passenger
  • the sum charged for riding in a public conveyance
  • an agenda of things to do
  • eat well
  • the food and drink that are regularly served or consumed
  • be the cause or source of
  • give or convey physically
  • break down, literally or metaphorically
  • give entirely to a specific person, activity, or cause
  • contribute to some cause
  • give food to
  • give or supply
  • give as a present; make a gift of
  • the elasticity of something that can be stretched and returns to its original length
  • transfer possession of something concrete or abstract to somebody
  • leave with; give temporarily
  • convey or reveal information
  • give (as medicine)
  • cause to have, in the abstract sense or physical sense
  • deliver in exchange or recompense
  • emit or utter
  • execute and deliver
  • estimate the duration or outcome of something
  • dedicate
  • inflict as a punishment
  • allow to have or take
  • guide or direct, as by behavior of persuasion
  • submit for consideration, judgment, or use
  • offer in good faith
  • manifest or show
  • convey or communicate; of a smile, a look, a physical gesture
  • convey, as of a compliment, regards, attention, etc.; bestow
  • bestow
  • proffer (a body part)
  • consent to engage in sexual intercourse with a man
  • propose
  • be flexible under stress of physical force
  • perform for an audience
  • present to view
  • bestow, especially officially
  • endure the loss of
  • move in order to make room for someone for something
  • organize or be responsible for
  • place into the hands or custody of
  • accord by verdict
  • cause to happen or be responsible for
  • transmit (knowledge or skills)
  • have room for; hold without crowding
  • be pertinent or relevant or applicable
  • understanding of the nature or meaning or quality or magnitude of something
  • cause to stop
  • drink alcohol without showing ill effects
  • support or hold in a certain manner
  • contain or hold; have within
  • lessen the intensity of; temper; hold in restraint; hold or keep within limits
  • the act of grasping
  • be capable of holding or containing
  • maintain (a theory, thoughts, or feelings)
  • organize or be responsible for
  • the appendage to an object that is designed to be held in order to use or move it
  • protect against a challenge or attack
  • a cell in a jail or prison
  • a stronghold
  • power by which something or someone is affected or dominated
  • a state of being confined (usually for a short time)
  • time during which some action is awaited
  • the space in a ship or aircraft for storing cargo
  • take and maintain control over, often by violent means
  • keep from departing
  • stop dealing with
  • remain in a certain state, position, or condition
  • have as a major characteristic
  • remain committed to
  • assert or affirm
  • hold the attention of
  • keep from exhaling or expelling
  • aim, point, or direct
  • have or hold in one's hands or grip
  • be the physical support of; carry the weight of
  • cover as for protection against noise or smell
  • secure and keep for possible future use or application
  • have rightfully; of rights, titles, and offices
  • arrange for and reserve (something for someone else) in advance
  • be valid, applicable, or true
  • keep in mind or convey as a conviction or view
  • have or possess, either in a concrete or an abstract sense
  • resist or confront with resistance
  • declare to be
  • to close within bounds, or otherwise limit or deprive of free movement
  • cause to continue in a certain state, position, or activity; e.g., keep clean'
  • the act of traveling from one place to another
  • undertake a journey or trip
  • travel upon or across
  • make by combining materials and parts
  • cause to do; cause to act in a specified manner
  • earn on some commercial or business transaction; earn as salary or wages
  • develop into
  • create by artistic means
  • make or cause to be or to become
  • perform or carry out
  • make, formulate, or derive in the mind
  • institute, enact, or establish
  • reach a destination, either real or abstract
  • achieve a point or goal
  • give certain properties to something
  • organize or be responsible for
  • a recognizable kind
  • proceed along a path
  • appear to begin an activity
  • carry out or commit
  • form by assembling individuals or constituents
  • constitute the essence of
  • amount to
  • be or be capable of being changed or made into
  • put in order or neaten
  • add up to
  • be suitable for
  • undergo fabrication or creation
  • change from one form into another
  • favor the development of
  • cause to be enjoyable or pleasurable
  • calculate as being
  • consider as being
  • eliminate urine
  • represent fictitiously, as in a play, or pretend to be or act like
  • assure the success of
  • behave in a certain way
  • act in a certain way so as to acquire
  • compel or make somebody or something to act in a certain way
  • make by shaping or bringing together constituents
  • gather and light the materials for
  • head into a specified direction
  • charge with a function; charge to be
  • reach a goal
  • to compose or represent
  • the month following February and preceding April
  • a steady advance
  • the act of marching; walking with regular steps (especially in a procession of some kind)
  • a procession of people walking together
  • a degree granted for the successful completion of advanced study of architecture
  • genre of music written for marching
  • district consisting of the area on either side of a border or boundary of a country or an area
  • force to march
  • cause to march or go at a marching pace
  • walk fast, with regular or measured steps; walk with a stride
  • march in a procession
  • march in protest; take part in a demonstration
  • walk ostentatiously
  • perform an action, or work out or perform (an action)
  • a change of position that does not entail a change of location
  • the act of changing location from one place to another
  • the act of deciding to do something
  • the act of changing your residence or place of business
  • dispose of by selling
  • live one's life in a specified environment
  • progress by being changed
  • propose formally; in a debate or parliamentary meeting
  • have a turn; make one's move in a game
  • go or proceed from one point to another
  • arouse sympathy or compassion in
  • move so as to change position, perform a nontranslational motion
  • change residence, affiliation, or place of employment
  • be in a state of action
  • follow a procedure or take a course
  • (game) a player's turn to take some action permitted by the rules of the game
  • cause to move or shift into a new position or place, both in a concrete and in an abstract sense
  • change location; move, travel, or proceed, also metaphorically
  • keep engaged
  • perform as expected when applied
  • perform a movement in military or naval tactics in order to secure an advantage in attack or defense
  • direct or control; projects, businesses, etc.
  • handle and cause to function
  • perform surgery on
  • be diffused
  • flee; take to one's heels; cut and run
  • include as the content; broadcast or publicize
  • a race between candidates for elective office
  • run, stand, or compete for an office or a position
  • keep company
  • move along, of liquids
  • continue to exist
  • perform as expected when applied
  • pursue for food or sport (as of wild animals)
  • cause something to pass or lead somewhere
  • stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • have a tendency or disposition to do or be something; be inclined
  • progress by being changed
  • direct or control; projects, businesses, etc.
  • compete in a race
  • a row of unravelled stitches
  • change or be different within limits
  • a small stream
  • a score in baseball made by a runner touching all four bases safely
  • the act of running; traveling on foot at a fast pace
  • a regular trip
  • a short trip
  • an unbroken chronological sequence
  • the production achieved during a continuous period of operation (of a machine or factory etc.)
  • unrestricted freedom to use
  • the continuous period of time during which something (a machine or a factory) operates or continues in operation
  • an unbroken series of events
  • the act of testing something
  • a race run on foot
  • cause an animal to move fast
  • move about freely and without restraint, or act as if running around in an uncontrolled way
  • deal in illegally, such as arms or liquor
  • set animals loose to graze
  • make without a miss
  • carry out a process or program, as on a computer or a machine
  • occur persistently
  • extend or continue for a certain period of time
  • be affected by; be subjected to
  • have a particular form
  • become undone
  • cause to perform
  • change from one state to another
  • be operating, running or functioning
  • carry out
  • cover by running; run a certain distance
  • move fast by using one's feet, with one foot off the ground at any given time
  • travel rapidly, by any (unspecified) means
  • run with the ball; in such sports as football
  • sail before the wind
  • come unraveled or undone as if by snagging
  • reduce or cause to be reduced from a solid to a liquid state, usually by heating
  • (American football) a play in which a player attempts to carry the ball through or past the opposing team
  • cause to emit recorded audio or video
  • pass over, across, or through
  • accompany or escort
  • (baseball) an advance to first base by a batter who receives four balls
  • the act of traveling by foot
  • the act of walking somewhere
  • a slow gait of a horse in which two feet are always on the ground
  • a path set aside for walking
  • manner of walking
  • careers in general
  • be or act in association with
  • live or behave in a specified manner
  • obtain a base on balls
  • give a base on balls to
  • take a walk; go for a walk; walk for pleasure
  • use one's feet to advance; advance by steps
  • make walk
  • traverse or cover by walking
  • walk at a pace
  • blend or harmonize
  • stop operating or functioning
  • a usually brief attempt
  • street names for methylenedioxymethamphetamine
  • be the right size or shape; fit correctly or as desired
  • perform as expected when applied
  • enter or assume a certain state or condition
  • lead, extend, or afford access
  • stretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
  • progress by being changed
  • have a turn; make one's move in a game
  • follow a procedure or take a course
  • give support (to) or make a choice (of) one out of a group or number
  • have a particular form
  • be in the right place or situation
  • pass from physical life and lose all bodily attributes and functions necessary to sustain life
  • move away from a place into another direction
  • begin or set in motion
  • follow a certain course
  • be abolished or discarded
  • to be spent or finished
  • be spent
  • make a certain noise or sound
  • be or continue to be in a certain condition
  • be contained in
  • be ranked or compare
  • functioning correctly and ready for action
  • continue to live and avoid dying
  • a board game for two players who place counters on a grid; the object is to surround and so capture the opponent's counters
  • a time period for working (after which you will be relieved by someone else)
  • go through in search of something; search through someone's belongings in an unauthorized way
  • change location; move, travel, or proceed, also metaphorically
  • pass, fare, or elapse; of a certain state of affairs or action
  • be awarded; be allotted
  • be sounded, played, or expressed
  • continue a certain state, condition, or activity
  • move ahead; travel onward in time or space
  • follow a procedure or take a course
  • continue talking
  • follow a certain course
  • mate with
  • put down or press the foot, place the foot
  • tread or stomp heavily or roughly
  • structural member consisting of the horizontal part of a stair or step
  • the part (as of a wheel or shoe) that makes contact with the ground
  • the grooved surface of a pneumatic tire
  • brace (an archer's bow) by pressing the foot against the center
  • crush as if by treading on
  • apply (the tread) to a tire
  • کِسی نُقطے يا مَرحَلے پَر پَہُنچ جانا
  • چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ

What is the synonym of chalna?

Synonym of word chalna are پَہُنچنا, آنا, آنا, چلنا, آ جانا, تشریف لانا, راستہ, سدھارنا, کھانا, ڈگرنا

What are the idioms related to chalna?

Here are the idioms that are related to the word chalna.

  • To operate
  • You will proceed most safely by the middle coures
  • March past
  • Rogue march
  • If you tell every step you will make a long journey

Paragraph Transliteration