qadam - قدم meanings in English
qadam - قدم meanings in English are foot, stets, steeds, stride, pace, measure, footstep, step, footfall, foot pace, yard qadam - قدم in English. More meanings of qadam - قدم, it's definitions, example sentences, related words, idioms and quotations.
foot stets steeds stride pace measure footstep step footfall foot pace yard
qadam - قدم Definitions
Please find 48 English and 3 Urdu definitions related to the word qadam - قدم.
- (noun) : the pedal extremity of vertebrates other than human beings
- (noun) : travel by walking
- (noun) : the part of the leg of a human being below the ankle joint
- (noun) : (prosody) a group of 2 or 3 syllables forming the basic unit of poetic rhythm
- (noun) : the sound of a step of someone walking
- (noun) : the sound of a step of someone walking
- (noun) : relative position in a graded series
- (noun) : the act of changing location by raising the foot and setting it down
- (noun) : support consisting of a place to rest the foot while ascending or descending a stairway
- (noun) : a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- (noun) : a short distance
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : a sequence of foot movements that make up a particular dance
- (noun) : a mark of a foot or shoe on a surface
- (noun) : a musical interval of two semitones
- (verb) : put down or press the foot, place the foot
- (verb) : walk a short distance to a specified place or in a specified manner
- (verb) : move with one's feet in a specific manner
- (verb) : furnish with steps
- (verb) : cause (a computer) to execute a single command
- (verb) : place (a ship's mast) in its step
- (verb) : move or proceed as if by steps into a new situation
- (verb) : shift or move by taking a step
- (noun) : the cardinal number that is the product of 10 and 100
- (noun) : the enclosed land around a house or other building
- (noun) : an enclosure for animals (as chicken or livestock)
- (noun) : a long horizontal spar tapered at the end and used to support and spread a square sail or lateen
- (noun) : an area having a network of railway tracks and sidings for storage and maintenance of cars and engines
- (noun) : a tract of land enclosed for particular activities (sometimes paved and usually associated with buildings)
- (noun) : a unit of volume (as for sand or gravel)
- (noun) : a tract of land where logs are accumulated
- (noun) : the sound of a step of someone walking
- (noun) : the act of taking a step in walking
- (noun) : musical notation for a repeating pattern of musical beats
- (noun) : a statute in draft before it becomes law
- (noun) : a basis for comparison; a reference point against which other things can be evaluated
- (verb) : express as a number or measure or quantity
- (noun) : any maneuver made as part of progress toward a goal
- (noun) : how much there is or how many there are of something that you can quantify
- (noun) : the act or process of assigning numbers to phenomena according to a rule
- (noun) : a container of some standard capacity that is used to obtain fixed amounts of a substance
- (verb) : have certain dimensions
- (verb) : evaluate or estimate the nature, quality, ability, extent, or significance of
- (noun) : measuring instrument having a sequence of marks at regular intervals; used as a reference in making measurements
- (verb) : determine the measurements of something or somebody, take measurements of
- (verb) : cover or traverse by taking long steps
- (verb) : walk with long steps
- (noun) : significant progress (especially in the phrase make strides')
- ٹانگ کا ٹَخنے کے نیچےوالاحِصّہ
- چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
More words related to the meanings of qadam - قدم
More words from English related to qadam - قدم
View an extensive list of words below that are related to the meanings of the word qadam - قدم meanings in English in English.
acidblundererrorfalling fault fiascofourguiltmisconceitmisgivingomissionparkagoraneglectquadrivialsquarevenial sinwrongyardchocsquarkquartesquareschoakactactionconscienceenemafunctionmotionoperationalperceptionadministrationdeedeffectexecutionexorcismexploitfeatgestmeasurenounoperationpracticeprocedureprocessworkworkingactuationsadherences ... enactionsimplementsimpletionimpletionsprocessesprosesadactproceresagedcasuistfootfoot markmondaydevoteedisciplefollowerfootstephierarcholdvotaryfootednessfootingforefootmonparrtoe intoetoefootboymondainperetoeingpyr appraiseestimateevaluategaugevaluejudgevaluateceremonialcraftgadgetmachinationmanoeuvremovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomdeceitdeceptionfashiongaitgimmickryguileindirectionruseshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcircumscriptioncloseenclosuregirdletermbawnfencelimitationmewpaleparvisseptperimetercircummurecoverallscourtpatiocortilecourtyardcourbcourbettecourtyardsforeyardyardagesyardlandsyeardyeardingyeardsyardfulscruxdifficultyinnjourneylegstageemblemmarkmottosemblancecarvingcharmengravingfeaturesimpressioninscriptionpaintingpicturestampembowelmentfaregiveholdmakemarchcomegooperatepaceproceedruntreadlikewalkstokingtreadingstreadlingfeetfoetorfootholdsfootingsfootlingsfootpadsfootrulefootrulesfootsfootsiefootwornoutfootoutfootsverseversiclepeagpugpiggp.a.pabetreaddisembarksteppingtrampletrampledjamtramplingtramplingsfoot pacestrideseasongrobianpendsfootfalltempovelocityspeedinesspacesspeansspeedsspeedstersvelocitiesspecesperagemodelcupmeterquantityquartscaleyardstickscaleyguessopinionsurmisesuppositionconjecturejudgementmensurationspeciatesupposalsupposititiousproemssupposingsimportancerhythmemphasishefthonourloadmetrerhymeweightweightinessweightingweenedweensweighageweighagesweighbaukweighingsweightingsweightswelshedweerishwexjumpleaphopjump overvaultsuppressionmeasuresInitiativesmullionrammeryardsosierphysicianrattanwattlewickerwillowchopferulelairquantifyfittfittefittesfittsfootledfettefit to
Idioms with the word qadam - قدم in it
Idioms related to the meaning of qadam - قدم
What are the meanings of qadam - قدم in English?
Meanings of the word qadam - قدم in English are foot, foot pace, footfall, pace, step, yard, footstep, measure, stride, steeds and stets. To understand how would you translate the word qadam - قدم in English, you can take help from words closely related to qadam - قدم or it’s English translations. Some of these words can also be considered qadam - قدم synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word qadam - قدم. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use qadam - قدم in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say qadam - قدم in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of qadam - قدم with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by قدم?
Meanings of قدم are foot, foot pace, footfall, pace, step, yard, footstep, measure, stride, steeds and stets
Whats the definition of قدم?
Definition of the قدم are
- the pedal extremity of vertebrates other than human beings
- travel by walking
- the part of the leg of a human being below the ankle joint
- (prosody) a group of 2 or 3 syllables forming the basic unit of poetic rhythm
- the sound of a step of someone walking
- the sound of a step of someone walking
- relative position in a graded series
- the act of changing location by raising the foot and setting it down
- support consisting of a place to rest the foot while ascending or descending a stairway
- a solid block joined to the beams in which the heel of a ship's mast or capstan is fixed
- a short distance
- any maneuver made as part of progress toward a goal
- a sequence of foot movements that make up a particular dance
- a mark of a foot or shoe on a surface
- a musical interval of two semitones
- put down or press the foot, place the foot
- walk a short distance to a specified place or in a specified manner
- move with one's feet in a specific manner
- furnish with steps
- cause (a computer) to execute a single command
- place (a ship's mast) in its step
- move or proceed as if by steps into a new situation
- shift or move by taking a step
- the cardinal number that is the product of 10 and 100
- the enclosed land around a house or other building
- an enclosure for animals (as chicken or livestock)
- a long horizontal spar tapered at the end and used to support and spread a square sail or lateen
- an area having a network of railway tracks and sidings for storage and maintenance of cars and engines
- a tract of land enclosed for particular activities (sometimes paved and usually associated with buildings)
- a unit of volume (as for sand or gravel)
- a tract of land where logs are accumulated
- the sound of a step of someone walking
- the act of taking a step in walking
- musical notation for a repeating pattern of musical beats
- a statute in draft before it becomes law
- a basis for comparison; a reference point against which other things can be evaluated
- express as a number or measure or quantity
- any maneuver made as part of progress toward a goal
- how much there is or how many there are of something that you can quantify
- the act or process of assigning numbers to phenomena according to a rule
- a container of some standard capacity that is used to obtain fixed amounts of a substance
- have certain dimensions
- evaluate or estimate the nature, quality, ability, extent, or significance of
- measuring instrument having a sequence of marks at regular intervals; used as a reference in making measurements
- determine the measurements of something or somebody, take measurements of
- cover or traverse by taking long steps
- walk with long steps
- significant progress (especially in the phrase make strides')
- ٹانگ کا ٹَخنے کے نیچےوالاحِصّہ
- چلنے میں ایک ہی پاوٴں کی دو ساکن حالتوں کے درمیان کا فاصلہ
- ناچنے کی حالت میں پاٴوں کی جگہ تبدیل کرنا
What is the synonym of قدم?
Synonym of word قدم are پیر, پاؤں, قدم, چرن, پگ, پا, پاوں, پَیر, پاؤں رکھنا, قدم رکھنا
What are the idioms with the word قدم?
Here are the idioms with the word قدم in them.
- Step by step one goes far
- A needy man is lost when he wishes to limitate a powerful man
- Hold or stand one ground
- If you tell every step you will make a long journey
- In smooth water god help me in rough water i will help myself
What are the idioms related to قدم?
Here are the idioms that are related to the word قدم.
- Step after step the ladder is ascended
- Step by step one goes far
- By the yard
- Yard of ale
- At a snail pace