saazish karna - سازش کرنا meanings in English
saazish karna - سازش کرنا meanings in English are conspire, plottering, conspiring, frame up, plot, manoeuvre, collude, machinate, league, plotting saazish karna - سازش کرنا in English. More meanings of saazish karna - سازش کرنا, it's definitions, example sentences, related words, idioms and quotations.
conspire plottering conspiring frame up plot manoeuvre collude machinate league plotting
saazish karna - سازش کرنا Definitions
Please find 24 English and definitions related to the word saazish karna - سازش کرنا.
- (verb) : engage in plotting or enter into a conspiracy, swear together
- (verb) : act in unison or agreement and in secret towards a deceitful or illegal purpose
- (noun) : an association of sports teams that organizes matches for its members
- (noun) : an association of states or organizations or individuals for common action
- (noun) : an obsolete unit of distance of variable length (usually 3 miles)
- (verb) : unite to form a league
- (verb) : engage in plotting or enter into a conspiracy, swear together
- (noun) : an action aimed at evading an opponent
- (noun) : a move made to gain a tactical end
- (noun) : a deliberate coordinated movement requiring dexterity and skill
- (noun) : a military training exercise
- (noun) : a plan for attaining a particular goal
- (verb) : act in order to achieve a certain goal
- (verb) : perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- (verb) : act in unison or agreement and in secret towards a deceitful or illegal purpose
- (noun) : an act that incriminates someone on a false charge
- (noun) : a secret scheme to do something (especially something underhand or illegal)
- (noun) : a small area of ground covered by specific vegetation
- (verb) : make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- (noun) : the story that is told in a novel or play or movie etc.
- (verb) : make a plat of
- (noun) : a chart or graph showing the movements or progress of an object
- (verb) : plan secretly, usually something illegal
- (verb) : devise the sequence of events in (a literary work or a play, movie, or ballet)
More words related to the meanings of saazish karna - سازش کرنا
More words from English related to saazish karna - سازش کرنا
View an extensive list of words below that are related to the meanings of the word saazish karna - سازش کرنا meanings in English in English.
accordblenchchafedco operatecomportconcurcongregatecorrespondentcoupleconnectfindfretgaingetgreetkneadknitleaguemashminglemixoccurquadratetallyclubcombineconsistintroducejoinmeetobtainconfreremeetnessactivenessagilityartfulnessfleetnessforwardnessfriskinessmanoeuvrepromptitudequirkinessruseslinessalacrityclevernesscraftinessdeftnessfoxinessfraud ... knacklivelinessmanipulationpertnesstacttactfulnesswilfulnessanimatenesspaltrinesssmarminesstrickinessclerkesscleruchyploidyploverypluviousslickeningsmarteningchalcographyclergialclerklinesscullyismimbecilitateincogitancyincogitativityinvigilancyplatnessaffiliationcompanypartnershipcompanionshipaffluxagreeablenessagreementco operationconcurrenceconfluenceconformityconsonanacecontiguitycombinationcoalitionsdirtfellowship grimejunctionliaisonmilemindednessmixturesymmetrytendencyamitycoincidencedirtinessdrossfilthfriendshipharmonyinducementmatchpropensitysullageunitymailemelmilesagreeclickapologuefolklorestorytalelegendmarchennarrativeplotsagayarnanecdoticanecdoticaltaeltalebearinganecdotagestoryingtalegallatalegallastalertalesmentelluralimposturejugglerymachinationcircumventiondeceptionguilequackerypearlinessceremonialcraftgadgetmotionmovemovementpassagespeedstepstrategysubterfugeactivityanticconductcustomdeceitfashiongaitgimmickryindirectionshenaniganstratagemtactictricktrickerywalkcrickfricktrick upwieldychalgimmeriddancestricklettricksierstricktrickmenttricktrackcouncilassemblyassociationconsortiumgroupmeetingorganisationsocietyunionassociationalconfederacyconcordalliancereunificationunanimityalliaceouscoalitionunificationunionisationunioniseunionismunionizationunitisationalliancesunionisesunionisingunionizesunitednessunitionintenerationunitudeunivocacyunivocationconspiracymisalliancecabalcollusioncomplotintrigueconcupiscenceconspectusintriguerintriganteconspersionconspicuityconspissationconspirecuremakeshiftadvicearrangementartificedeliberationdevicegimmickginopinionorderplanpolicygradualitymaneuverabilitymanoeuvrabilitytacticaltractarianismgradinetactualityplacitorystipulasustulategrudgehostilitytaxaffectionaffinityanimosityantagonismattachmentcorrelationill feelingloverelationrelevancyloggeleaguedleagueredliggedaresayokassentingconcretiseconcretizemachinatemacrocosmallitrationepigramingenuityquibblequirkskilluniversaluniversewitworldmakemakingnaturesynthesistempercompositionconfigurationconstructiondecoctioninventionmethodmoderecipesyntagmsyntagmasynthesistsynthetismsyntagmatasyntansyntanssyntexissynthesessyntheticssynthetisesynthronussyntoniessyntonisesyntonisessyntonizessyntonysynanthesissyntomyturcismmanipulatejockeycontrivecountervailwaitinningopportunityturnmurderambushmaximphilosophysciencescontrivancediplomacyknowledgewisdomwisenessoverturetabulatesprojectproposalrecommendationschemesuggestionpropositussuggestibilitydiscommendpreposedpropensionpropinespropiningproposestipsifyingdiscommendationpresupposalpropicepropinationsuggestmentprogramconcotiondemarcheprogrammeterrainpatchcolludegimmickedgimmickinggimmickyplonkingprocliveumbilication
Idioms with the word saazish karna - سازش کرنا in it
Idiom related to the meaning of saazish karna - سازش کرنا
English | اردو |
---|---|
Plot proof | مکمل محفوظ |
What are the meanings of saazish karna - سازش کرنا in English?
Meanings of the word saazish karna - سازش کرنا in English are conspire, league, machinate, manoeuvre, collude, frame up, plot, conspiring, plottering and plotting. To understand how would you translate the word saazish karna - سازش کرنا in English, you can take help from words closely related to saazish karna - سازش کرنا or it’s English translations. Some of these words can also be considered saazish karna - سازش کرنا synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word saazish karna - سازش کرنا. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use saazish karna - سازش کرنا in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say saazish karna - سازش کرنا in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of saazish karna - سازش کرنا with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by سازش کرنا?
Meanings of سازش کرنا are conspire, league, machinate, manoeuvre, collude, frame up, plot, conspiring, plottering and plotting
Whats the definition of سازش کرنا?
Definition of the سازش کرنا are
- engage in plotting or enter into a conspiracy, swear together
- act in unison or agreement and in secret towards a deceitful or illegal purpose
- an association of sports teams that organizes matches for its members
- an association of states or organizations or individuals for common action
- an obsolete unit of distance of variable length (usually 3 miles)
- unite to form a league
- engage in plotting or enter into a conspiracy, swear together
- an action aimed at evading an opponent
- a move made to gain a tactical end
- a deliberate coordinated movement requiring dexterity and skill
- a military training exercise
- a plan for attaining a particular goal
- act in order to achieve a certain goal
- perform a movement in military or naval tactics in order to secure an advantage in attack or defense
- act in unison or agreement and in secret towards a deceitful or illegal purpose
- an act that incriminates someone on a false charge
- a secret scheme to do something (especially something underhand or illegal)
- a small area of ground covered by specific vegetation
- make a schematic or technical drawing of that shows interactions among variables or how something is constructed
- the story that is told in a novel or play or movie etc.
- make a plat of
- a chart or graph showing the movements or progress of an object
- plan secretly, usually something illegal
- devise the sequence of events in (a literary work or a play, movie, or ballet)
What is the synonym of سازش کرنا?
Synonym of word سازش کرنا are بندش باندھنا, سازش کرنا, گشٹی کرنا, ساز باز یا گٹھ جوڑ کرنا, ساز باز کرنا, میل, گٹھاؤ, آنٹ سانٹھ, اتحاد, رفاقت
What are the idioms with the word سازش کرنا?
Here are the idioms with the word سازش کرنا in them.
- A foult once denied is twice committed
- A promise attended to is a debt settle
- Always to excel and to be superior to others
- Cudgel one's brains
- Fly in the face of
What are the idioms related to سازش کرنا?
Here are the idioms that are related to the word سازش کرنا.
- Plot proof