munh - منہ meanings in English
munh - منہ meanings in English are hole, stouth, outhire, mouths, fouth, mouthwash, orifice, nozzle, kisser, gob, face, opening, muzzle, mouth munh - منہ in English. More meanings of munh - منہ, it's definitions, example sentences, related words, idioms and quotations.
hole stouth outhire mouths fouth mouthwash orifice nozzle kisser gob face opening muzzle mouth mouth
munh - منہ Definitions
Please find 71 English and 1 Urdu definitions related to the word munh - منہ.
- (noun) : impudent aggressiveness
- (verb) : deal with (something unpleasant) head on
- (verb) : present somebody with something, usually to accuse or criticize
- (verb) : oppose, as in hostility or a competition
- (noun) : a vertical surface of a building or cliff
- (noun) : the side upon which the use of a thing depends (usually the most prominent surface of an object)
- (noun) : the striking or working surface of an implement
- (noun) : the general outward appearance of something
- (noun) : status in the eyes of others
- (noun) : the front of the human head from the forehead to the chin and ear to ear
- (noun) : the part of an animal corresponding to the human face
- (noun) : a part of a person that is used to refer to a person
- (noun) : a contorted facial expression
- (noun) : a specific size and style of type within a type family
- (verb) : turn so as to expose the face
- (verb) : be opposite
- (verb) : cover the front or surface of
- (verb) : line the edge (of a garment) with a different material
- (verb) : turn so as to face; turn the face in a certain direction
- (verb) : be oriented in a certain direction, often with respect to another reference point; be opposite to
- (noun) : the feelings expressed on a person's face
- (noun) : an opening deliberately made in or through something
- (noun) : one playing period (from tee to green) on a golf course
- (noun) : an opening into or through something
- (noun) : a depression hollowed out of solid matter
- (noun) : an unoccupied space
- (noun) : a fault
- (noun) : informal terms for the mouth
- (verb) : make holes in
- (verb) : hit the ball into the hole
- (noun) : an impudent or insolent rejoinder
- (noun) : the opening of a jar or bottle
- (noun) : the externally visible part of the oral cavity on the face and the system of organs surrounding the opening
- (noun) : the opening through which food is taken in and vocalizations emerge
- (noun) : the point where a stream issues into a larger body of water
- (noun) : an opening that resembles a mouth (as of a cave or a gorge)
- (noun) : a person conceived as a consumer of food
- (noun) : a spokesperson (as a lawyer)
- (verb) : articulate silently; form words with the lips only
- (verb) : touch with the mouth
- (verb) : express in speech
- (noun) : restraint put into a person's mouth to prevent speaking or shouting
- (verb) : prevent from speaking out
- (verb) : tie a gag around someone's mouth in order to silence them
- (noun) : forward projecting part of the head of certain animals; includes the jaws and nose
- (noun) : a leather or wire restraint that fits over an animal's snout (especially a dog's nose and jaws) and prevents it from eating or biting
- (noun) : the open circular discharging end of a gun
- (verb) : fit with a muzzle
- (noun) : an open or empty space in or between things
- (noun) : the act of opening something
- (noun) : becoming open or being made open
- (noun) : a vacant or unobstructed space that is man-made
- (noun) : the initial part of the introduction
- (noun) : the first performance (as of a theatrical production)
- (noun) : a ceremony accompanying the start of some enterprise
- (noun) : opportunity especially for employment or promotion
- (noun) : an entrance equipped with a hatch; especially a passageway between decks of a ship
- (noun) : a possible alternative
- (noun) : the first of a series of actions
- (adjective) : first or beginning
- (noun) : a recognized sequence of moves at the beginning of a game of chess
- (noun) : an aperture or hole that opens into a bodily cavity
- (noun) : informal terms for the mouth
- (noun) : a man who serves as a sailor
- (noun) : a lump of slimy stuff
- (noun) : someone who kisses
- (noun) : the human face ( kisser' and smiler' and mug' are informal terms for face' and phiz' is British)
- (noun) : a medicated solution used for gargling and rinsing the mouth
- (noun) : informal terms for the nose
- (noun) : a projecting spout from which a fluid is discharged
- (noun) : an aperture or hole that opens into a bodily cavity
- تقریر اور تحریر کی ممانعت کرنا
More words related to the meanings of munh - منہ
More words from English related to munh - منہ
View an extensive list of words below that are related to the meanings of the word munh - منہ meanings in English in English.
accumulationagglomerationbankcongeriescongregationdrift massmuchmucuspileabundantbingbulkgobheaphillockjumblekittymoundrickruckstockpileheap upheapspile uppileupheapedheapingpiledpileouspileworkaffectationartificialityconstructionconcoctionconformationdispositionedificationequipmentfacefalsification feignfeint fictionfigmentforgingmakemanufacturenaturesham ... textureaffectblandishmentconstitutionexaggerationfabricmake upmakingputting on airssimulationstructurestructuraltexturedtextlesstexturestexturingtexturisetexturisedtexturisestexturizedtexturizesair cellcrevice crannyholeleakmortiseopeningventborehollowinletmouthpassagevacancyperforatedperforationholesopeningsostiolesapparitioncontourfairnessfigureidealikenesspersonagesimilitudefeatureimagemodevisageroopconfigurationconjunctureemblemeventualityguiselikelihoodlinementmannerphasephasissemblancesymmetryappearancecaseconditioncountenanceformgestaltmienmodalityplightprocessshapeeffigy aspectdiagramformationget upmodelnumeralpatternstatevarietywayshape upamorphismarchmasterprincipalbeefybreakfragmentsegmentbitpieceslicecleavagefissurefracturegapgulfkerfslitcrackhiatusintersticenotchsplitstomacracklewarecracklingscragfastcragsmanscruffcrackjawcracknelcracknelscrackpotsscugsfobilebreachchasmdissonance lacunaobstaclebungalowcapsuledwellingedificefire sidehomehousenestbirthplacedynastyfamilyhabitathabitationholderresidenceshebangsourcespacehouherehomedhouselcolumnsgroovecompartmentdivisionpanelpartitionpigeonholereceptacleroomsectioncheekjowlchalkmillcleftcutincisionmillstonepotter's wheelchalkedchalksclauschinkclausecleaveagekindpartrentriftrimasortclausalclausulaclausulaeclausurefeaturedmaskfaceliftfaceplatefacervolte facefeckfacoundrabbetflawseamwindowrosenventagehole uppiercedunpiercedpieridspierrotsporedporesdirectionfacadefacetinclinationrocsideoverflowcurrentfrontstreamsurfaceoutsideforepartfortuitychancehapinningoutlookoverturechance onchance uponchanceyoccasionalityoccursiongategatewayvalvedooringressionportdoorcasedoorplatedoorwaydoorgadoorsteadyearyearsyearliesyearthmorselmouthfulwadgobbetcombustibilitycombustiblenesscombustsmuzzlepluggagmuffledhushnozzlenebgracehonournosesnootsnotnosepiecenosewheelnasalisesnasalsnasutenosegaysnosersnosesnoseysnoselnosleoppugnoutfaceapposeconfrontencounterface upaffrontingfacetingosculatorykisserbodyiconpackagerpackersastronomygarbgenrelineamentphysiquefaucetjetnose piecespigottapfaucetsorifice
Idioms with the word munh - منہ in it
Idioms related to the meaning of munh - منہ
What are the meanings of munh - منہ in English?
Meanings of the word munh - منہ in English are face, hole, mouth, muzzle, opening, gob, kisser, mouthwash, nozzle, orifice, fouth, mouths, outhire and stouth. To understand how would you translate the word munh - منہ in English, you can take help from words closely related to munh - منہ or it’s English translations. Some of these words can also be considered munh - منہ synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word munh - منہ. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use munh - منہ in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say munh - منہ in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of munh - منہ with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by منہ?
Meanings of منہ are face, hole, mouth, muzzle, opening, gob, kisser, mouthwash, nozzle, orifice, fouth, mouths, outhire and stouth
Whats the definition of منہ?
Definition of the منہ are
- impudent aggressiveness
- deal with (something unpleasant) head on
- present somebody with something, usually to accuse or criticize
- oppose, as in hostility or a competition
- a vertical surface of a building or cliff
- the side upon which the use of a thing depends (usually the most prominent surface of an object)
- the striking or working surface of an implement
- the general outward appearance of something
- status in the eyes of others
- the front of the human head from the forehead to the chin and ear to ear
- the part of an animal corresponding to the human face
- a part of a person that is used to refer to a person
- a contorted facial expression
- a specific size and style of type within a type family
- turn so as to expose the face
- be opposite
- cover the front or surface of
- line the edge (of a garment) with a different material
- turn so as to face; turn the face in a certain direction
- be oriented in a certain direction, often with respect to another reference point; be opposite to
- the feelings expressed on a person's face
- an opening deliberately made in or through something
- one playing period (from tee to green) on a golf course
- an opening into or through something
- a depression hollowed out of solid matter
- an unoccupied space
- a fault
- informal terms for the mouth
- make holes in
- hit the ball into the hole
- an impudent or insolent rejoinder
- the opening of a jar or bottle
- the externally visible part of the oral cavity on the face and the system of organs surrounding the opening
- the opening through which food is taken in and vocalizations emerge
- the point where a stream issues into a larger body of water
- an opening that resembles a mouth (as of a cave or a gorge)
- a person conceived as a consumer of food
- a spokesperson (as a lawyer)
- articulate silently; form words with the lips only
- touch with the mouth
- express in speech
- restraint put into a person's mouth to prevent speaking or shouting
- prevent from speaking out
- tie a gag around someone's mouth in order to silence them
- forward projecting part of the head of certain animals; includes the jaws and nose
- a leather or wire restraint that fits over an animal's snout (especially a dog's nose and jaws) and prevents it from eating or biting
- the open circular discharging end of a gun
- fit with a muzzle
- an open or empty space in or between things
- the act of opening something
- becoming open or being made open
- a vacant or unobstructed space that is man-made
- the initial part of the introduction
- the first performance (as of a theatrical production)
- a ceremony accompanying the start of some enterprise
- opportunity especially for employment or promotion
- an entrance equipped with a hatch; especially a passageway between decks of a ship
- a possible alternative
- the first of a series of actions
- first or beginning
- a recognized sequence of moves at the beginning of a game of chess
- an aperture or hole that opens into a bodily cavity
- informal terms for the mouth
- a man who serves as a sailor
- a lump of slimy stuff
- someone who kisses
- the human face ( kisser' and smiler' and mug' are informal terms for face' and phiz' is British)
- a medicated solution used for gargling and rinsing the mouth
- informal terms for the nose
- a projecting spout from which a fluid is discharged
- an aperture or hole that opens into a bodily cavity
- تقریر اور تحریر کی ممانعت کرنا
What is the synonym of منہ?
Synonym of word منہ are بناوٹ, روپ, صورت, شکل, رخسار, چہرہ, رخ, رو, چہرہ مہرہ, ظاہری صورت
What are the idioms with the word منہ?
Here are the idioms with the word منہ in them.
- We give to the rich and take from the poor
- A river you contend with the sea
- Small wit great boast
- A river you contend with the sea
- An ill deed cannot bring honour
What are the idioms related to منہ?
Here are the idioms that are related to the word منہ.
- God never sends mouths but he sends meat
- Many mouths many talks
- Face to face
- A hole in one coat
- A square peg in a round hole