جگر - Jigar in English
جگر - Jigar Definitions
Please find 6 English definitions related to the word جگر - Jigar.
- Geiger - (noun) : German physicist who developed the Geiger counter (1882-1945)
- Heart - (noun) : a positive feeling of liking
- Hepatic - (noun) : any of numerous small green nonvascular plants of the class Hepaticopsida growing in wet places and resembling green seaweeds or leafy mosses
- Liver - (noun) : large and complicated reddish-brown glandular organ located in the upper right portion of the abdominal cavity; secretes bile and functions in metabolism of protein and carbohydrate and fat; synthesizes substances involved in the clotting of the blood; synthesizes vitamin A; detoxifies poisonous substances and breaks down worn-out erythrocytes
- Mind - (noun) : your intention; what you intend to do
- Soul - (noun) : the human embodiment of something
More words related to the meanings of جگر - Jigar
More words from English related to جگر - Jigar
View an extensive list of words below that are related to the meanings of the word جگر - Jigar in English in English.
accedeacquiescecommemorationconcededisbelieve homologatemindvenerateyieldacceptacknowledgeadmitaffordagreeallowassumebelieveconsentholdkeepobeyreceiveregardadmissiveaccededadeemingadhibitadhibitingadhibitsadmixingconceivingconjectobequitatesupputateaccountdeferheedrespectside withenvisionfancyguessimaginesupposethinkcareconsiderfigureobservepremeditate ...
Idioms related to the meaning of جگر - Jigar
What are the meanings of جگر - Jigar in English?
Meanings of the word جگر - Jigar in English are liver, mind, geiger, heart, hepatic, soul, alluvions, hepatical, hepatics, liveries, jager, jugger and livering. To understand how would you translate the word جگر - Jigar in English, you can take help from words closely related to جگر - Jigar or it’s English translations. Some of these words can also be considered جگر - Jigar synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word جگر - Jigar. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use جگر - Jigar in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say جگر - Jigar in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of جگر - Jigar with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by jigar?
Meanings of jigar are alluvions, geiger, heart
What is the synonym of jigar?
Synonym of word jigar are جگر, کلیجا, کبد, کلیجی, ماننا, لحاظ کرنا, خیال کرنا, میلان, دماغ, غور کرنا
What are the idioms related to jigar?
Here are the idioms that are related to the word jigar.
- ایک ہی دوا سب بیماریوں کے لئے نافع نہیں
- بے تکلف اور آزاد
- پاک جامہ پہن لینے سے ناپاک روح صاف نہیں ہو جاتی
- بعض اوقات چھوٹے دِلوں میں بھی بڑے کام کرنے کی قوت ہوتی ہے
- تِلوار کا گھاوٴ بھر جاتا ہے زُبان کا گھاوٴ نہیں بھرتا