مداخلت - Mudaakhlat in English
Meanings of مداخلت - Mudaakhlat in English are access, admission, encroachment. More meanings of مداخلت - mudaakhlat in english, it's definitions, example sentences, related words, idioms and quotations.
encroachmentpragmatismaccessadmissionincursioninterceptionintercurrenceinterferenceinterventionintrusioninvasioninterbredinterbreedinterbreedinginterferinginterreflectionintrustinterferesinterfusedinterfusesintermentsinterposedinterringintertiesinterveininterveinsintrusionsintrustedintrustsmeddledmeddlesintercentrumintercominginterdigitationinterduceinterferinglyinterfrettedintermentionintermigrationinterminationintervenienceinterveniencyintervenientinterventinterwreatheintreatanceintromittent
مداخلت - Mudaakhlat Definitions
Please find 16 English definitions related to the word مداخلت - Mudaakhlat.
- Access - (noun) : the act of approaching or entering
- Admission - (noun) : the right to enter
- Encroachment - (noun) : influencing strongly
- Incursion - (noun) : the act of entering some territory or domain (often in large numbers)
- Interbred - (adjective satellite) : bred of closely related parents
- Interbreed - (verb) : breed animals or plants using parents of different races and varieties
- Interbreeding - (noun) : (genetics) the act of mixing different species or varieties of animals or plants and thus to produce hybrids
- Interception - (noun) : (American football) the act of catching a football by a player on the opposing team
- Interference - (noun) : electrical or acoustic activity that can disturb communication
- Interfering - (adjective satellite) : intrusive in a meddling or offensive manner
- Interreflection - (noun) : reciprocal reflection between two reflecting surfaces
- Intervention - (noun) : a policy of intervening in the affairs of other countries
- Intrusion - (noun) : entry to another's property without right or permission
- Intrust - (verb) : confer a trust upon
- Invasion - (noun) : any entry into an area not previously occupied
- Pragmatism - (noun) : (philosophy) the doctrine that practical consequences are the criteria of knowledge and meaning and value
More words related to the meanings of مداخلت - Mudaakhlat
More words from English related to مداخلت - Mudaakhlat
View an extensive list of words below that are related to the meanings of the word مداخلت - Mudaakhlat in English in English.
acceptanceapprobationhomageadmissionadmitteddeferencegreetingshonouringrenditionresignationsalutationsubmissionsurrendersubulateversifiesadmitaccessmarketroutewaitpathwayweightgangwaygatetrackventwaycoursecustomheadwayjourneymethodpathprogressroadroadmapwentgutavenuecarrotentranceegresspassagepassingtravelcontactcommunicationmovementtransportationacknowledgement ...
Idiom related to the meaning of مداخلت - Mudaakhlat
| English | اردو |
|---|---|
| Open access | آسان پہنچ |
What are the meanings of مداخلت - Mudaakhlat in English?
Meanings of the word مداخلت - Mudaakhlat in English are access, encroachment, pragmatism, admission, incursion, interbred, interbreed, interbreeding, interception, interference, interfering, interreflection, intervention, intrusion, intrust, invasion, interferes, interfused, interfuses, interments, interposed, interring, interties, intervein, interveins, intrusions, intrusted, intrusts, meddled, meddles, intercentrum, intercoming, intercurrence, interdigitation, interduce, interferingly, interfretted, intermention, intermigration, intermination, intervenience, interveniency, intervenient, intervent, interwreathe, intreatance and intromittent. To understand how would you translate the word مداخلت - Mudaakhlat in English, you can take help from words closely related to مداخلت - Mudaakhlat or it’s English translations. Some of these words can also be considered مداخلت - Mudaakhlat synonyms. In case you want even more details, you can also consider checking out all of the definitions of the word مداخلت - Mudaakhlat. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. These idioms or quotations can also be taken as a literary example of how to use مداخلت - Mudaakhlat in a sentence. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu.
We have tried our level best to provide you as much detail on how to say مداخلت - Mudaakhlat in English as possible so you could understand its correct Urdu to English translation. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Although we have added all of the meanings of مداخلت - Mudaakhlat with utmost care but there could be human errors in the translation. So if you encounter any problem in our translation service please feel free to correct it at the spot. All you have to do is to click here and submit your correction.
Frequently Asked Questions (FAQ)
What do you mean by mudaakhlat?
Meanings of mudaakhlat are access, admission, encroachment
What is the synonym of mudaakhlat?
Synonym of word mudaakhlat are باٹ, راہ, رستہ, آر جار, گزر, آنا جانا, آمد و رفت, دخل, دسترس, گزارہ
What are the idioms related to mudaakhlat?
Here are the idioms that are related to the word mudaakhlat.
- آسان پہنچ